KEGG   Sulfuricurvum kujiense: Sulku_1389Help
Entry
Sulku_1389        CDS       T01370                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  
recombination protein RecR
Organism
sku  Sulfuricurvum kujiense
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sku00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sulku_1389
DNA repair and recombination proteins [BR:sku03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Sulku_1389
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sulku_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1399461..1400030)
Genome map
AA seq 189 aa AA seqDB search
MKRSLEKFNRLVDALQNLPTVGQKSATRLAYHMVMNDSFGALKLAHAIENAITSLKKCRS
CGGLSEDELCSICSDERRNHEVLCIVENAKDILTFEENGLFDGRYFVLDSIEELDIAHLR
GVIQSGIKEVIFALTPSIANQGVMLYIEDKLIDCDVRFSRIAQGVPTGVSLENVDILSLT
KAMEDRVSI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttcccttgaaaaatttaaccgccttgtcgatgccctccaaaatctcccgacc
gtcgggcagaaatcggcgacccgtttagcctatcatatggttatgaacgacagcttcggg
gcacttaaactcgcccatgcgatcgaaaatgctattacctctttgaaaaaatgccgttcc
tgcggtggattgagcgaagatgaactgtgttcgatttgcagtgatgagcggcgtaatcat
gaagtgctttgtattgtcgaaaatgccaaagatattttgacctttgaagaaaacggcctt
tttgacggtcgttattttgttttagactctatagaagagcttgatatagcccatttgcgc
ggagtgatccaaagcggaatcaaagaggtgattttcgcattgaccccatcgatcgccaat
cagggagttatgctctatatcgaagataaactgatcgattgcgatgtccgattcagccga
atcgcgcagggggttccgacgggtgtgagtttggaaaacgtcgatatactatcgcttacc
aaagcgatggaagaccgcgtcagcatataa

DBGET integrated database retrieval system