KEGG   Sulfuricurvum kujiense: Sulku_1461Help
Entry
Sulku_1461        CDS       T01370                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sku  Sulfuricurvum kujiense
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sulku_1461
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sulku_1461
   00640 Propanoate metabolism
    Sulku_1461
   00660 C5-Branched dibasic acid metabolism
    Sulku_1461
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Sulku_1461
Enzymes [BR:sku01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sulku_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1474444..1475613)
Genome map
AA seq 389 aa AA seqDB search
MNIHEYQAKELFKKYNVPTPRGHIAFTPDEAVKAAQELGGSVWVVKAQIHAGGRGLGGGV
KLARSTSEVRELASQILGMQLVTHQTGPEGKLVQKVYIEEGADIKKEYYLGMLLDRASEM
PIMMASTEGGMAIEDVAHDSPEKIIKVAIDPLTGFQSFHGRKLAFGLGLPVEEINTFIKF
ASALYRVYMDHDAEMIEINPLIKTGDGKFLALDAKMGFDNNALYRQSQVNEMRDLSEEEP
TEIEAGKFGLSYIKLDGDVGCMVNGAGLAMGTMDTINYEGGKPANFLDVGGGANAETVAK
GFEIILKDPNVKAIFVNIFGGIVRCDRVANGILEATKLTKVDVPVIVRLDGTNAIEAAEI
LNNAGISNIIAATDLADGARKAVAAAKGA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaatatcaagctaaagaactattcaaaaaatacaacgtaccgacaccg
cgcggtcacattgcttttacaccggatgaggctgttaaagcggcacaagaactcggcggc
agtgtttgggtggttaaagctcaaattcatgccggcggacgcggtttgggcggcggggtt
aaacttgcccgttctacttctgaagtacgcgaattggccagtcaaattctcggtatgcag
ctcgttacacatcaaactggaccggaaggtaaactcgtacaaaaagtttacatagaagag
ggtgcggacattaaaaaagagtactacctgggtatgttgcttgaccgtgcatcggaaatg
ccgatcatgatggcatcaactgagggtggtatggcgattgaagatgttgcacacgattct
ccggaaaagattatcaaagtagccatcgatccgttgacagggtttcaaagtttccacggg
cgcaaattggcgttcggtctcggacttccggtcgaagagatcaatacgtttatcaaattt
gcatccgcactttatcgtgtctacatggatcacgatgccgagatgatcgaaatcaatccg
ttgatcaaaacgggtgacggcaaattcttggcgcttgatgcgaaaatgggatttgataac
aacgccctttatcgccaatcgcaagtgaatgaaatgcgtgatttgagcgaagaagaaccg
actgaaatcgaagcgggcaaattcggtcttagctatatcaaacttgacggtgacgtcggt
tgtatggttaacggtgccggtcttgcgatgggtacgatggatacgatcaactatgaaggc
ggaaaaccggctaacttccttgacgtgggcggcggagcaaatgccgaaaccgttgcaaaa
gggttcgaaatcattttgaaagacccgaacgtaaaagcgatttttgtcaatattttcggc
ggaattgttcgttgtgaccgtgttgcaaacggtattttggaagcgacaaaactgacgaaa
gtcgatgtaccggttatcgttcgtctggatggaaccaacgcaattgaagcggctgaaatt
ttaaacaatgccggaatctcaaatatcattgctgctaccgatcttgcagacggtgcgcgt
aaagccgttgcagcagcaaaaggagcataa

DBGET integrated database retrieval system