KEGG   Sulfuricurvum kujiense: Sulku_1498Help
Entry
Sulku_1498        CDS       T01370                                 

Definition
mo-nitrogenase mofe protein subunit nifd (EC:1.18.6.1)
Orthology
K02586  
nitrogenase molybdenum-iron protein alpha chain [EC:1.18.6.1]
Organism
sku  Sulfuricurvum kujiense
Pathway
Chloroalkane and chloroalkene degradation
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Nitrogen fixation, nitrogen => ammonia
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:sku00910]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sku00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1516794..1518263)
Genome map
AA seq 489 aa AA seqDB search
MGPETLEAKQKAAIEEILKAYPEKAAKNREKHLGVGSPNDENQKTCGDVRSNKKTVPGVM
SQRGCAYAGSKGVVWGPVKDMIHISHGPIGCGQYSRAGRRNYYIGVTGVDTFVTMNFCSD
FQENNIVFGGDKKLGQCIDEIETLFPLNNGITVQSECPIGLIGDDIAAVAKTKAKEIGKT
IVPVNCEGFRGVSQSLGHHIANDAVRDYIFEGDLSHIQTNDVTPTEYDVAIIGDYNIGGD
TWSSRILLEEMGLRVVAQWSGDATLKEMALTPKVKLNLLHCYRSMNYISRHMEKEFGIPW
VEYNFFGPSQTIKSLRKIASFFDESIQKKCEEVIAKYQPMIDAVIAKYKPRLEGKQVMLF
VGGLRPRHVIGAYEDLGMEVIGTGYEFAHDDDYKRTKEEIFRSTVIYDDVNEYELEAFVK
KLQPDLVASGIKEKYVFQKMGLPYRQMHSWDYSGPYHGYDGFAIFAQDMDLAINSPVWAH
SKAPWEKEG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgggtccagaaacactagaagctaaacaaaaagcggccattgaagagatcttaaaagcg
tatcctgagaaagcggcaaaaaaccgtgaaaaacatctcggtgtcggatctcctaatgat
gaaaatcaaaaaacgtgcggagatgtccgctctaacaaaaaaaccgttccgggtgtaatg
agccaacgcggttgtgcttatgcaggttctaaaggggttgtatggggtcctgtcaaagac
atgatccatatctctcacggtcctatcggatgcggtcaatatagccgtgcaggtcgtcgt
aactattacatcggtgtaaccggtgttgatacattcgttacaatgaacttctgttcggat
ttccaagaaaacaacatcgttttcggtggagataaaaaattgggtcaatgtatcgatgaa
atcgaaactcttttcccattgaataacggtatcactgttcaatcagagtgtccgatcggt
ttgatcggggatgatatcgctgcggttgctaaaaccaaagcaaaagaaatcggtaaaacg
atcgttccggtcaactgcgaaggtttccgcggggtgtctcaatcactcggtcaccatatc
gccaacgatgcggttcgtgactacatttttgaaggtgaccttagccacattcaaacaaat
gacgttacaccgactgagtatgacgttgcgatcatcggtgactataacatcggtggagat
acatggtcaagccgtatccttcttgaggaaatgggtcttcgtgtcgttgcacaatggtca
ggagatgctactcttaaagagatggcattgactccaaaagttaaattgaacttgcttcac
tgctaccgttcaatgaactatatcagccgtcacatggaaaaagaattcgggattccgtgg
gtagagtataacttcttcggaccgagccaaacgatcaaatcacttcgcaaaatcgcgtcg
ttctttgatgagagcatccaaaagaaatgtgaagaagttatcgctaaatatcaaccgatg
atcgatgcggttatcgcgaaatacaaaccacgtcttgaagggaaacaagtaatgttgttc
gtcggcggtcttcgccctcgtcacgttatcggtgcctatgaagatttgggtatggaagta
atcggaacaggttatgagtttgctcatgatgacgactacaaacgtactaaagaagagatt
ttccgctcaaccgttatctacgatgacgtcaatgagtatgaacttgaagcgttcgttaaa
aaacttcaacctgaccttgtagcttcagggatcaaagagaagtatgtattccaaaaaatg
ggtcttccgtatcgtcagatgcactcatgggattacagcggaccttaccacgggtacgac
ggattcgccattttcgcccaggatatggatcttgcgatcaactctcctgtatgggcacat
tccaaagcaccatgggagaaagagggctga

DBGET integrated database retrieval system