KEGG   Sulfuricurvum kujiense: Sulku_1566Help
Entry
Sulku_1566        CDS       T01370                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sku  Sulfuricurvum kujiense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulku_1566
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sulku_1566
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sulku_1566
Enzymes [BR:sku01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sulku_1566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1577766..1578965
Genome map
AA seq 399 aa AA seqDB search
MYIPSPSKFDPVDGHFGIFGGRYVPETLMPALLELEEAYKEIRFDETFWSEVDGYLRDYV
GRPSPLYYAANLSEELGAKIYLKREDLNHTGAHKVNNVIAQGLMAKRLGKKKVIAETGAG
QHGVATATIAALLGLECEIFMGAKDVARQELNVFRMKLLGAKVHAVESGSKTLKDAMNDA
IRHWVTHARDTFYIIGTVAGPHPYPMMVRDFQAIIGCEARAQILEKEKRLPDYVIACIGG
GSNAIGTFQHFLEDKEVRCIGIEAGGLGVETDKHGCSLLKGRPGVLHGQMSYLLQDEDGQ
ILQAHSISAGLDYPGIGPEHAFHKDNDTVSYDNITDDEALDAFVWLSRREGIIPAFESSH
AVAYLKKMPDIKGKLVIVNLSGRGDKDMIQAKQILNFDN
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtacatccctagcccttctaaatttgatccggttgacggacacttcggcatcttcgga
ggacgttatgtccccgaaacattaatgcctgctttgctggagcttgaagaagcctacaaa
gagatccgcttcgacgaaacattctggagcgaagtcgacggctatctgcgtgattatgtc
ggtcgtccgagtcctctgtattatgccgccaatctctccgaagagttgggagccaaaatc
tatctcaagcgggaagatttgaaccacacgggtgcccataaagtcaataatgtcattgcg
cagggattgatggcgaaacgtttgggcaagaaaaaagtgatcgccgaaacaggcgcgggt
cagcacggtgtcgctaccgcaacgatcgccgcacttttgggattggaatgcgaaatcttc
atgggagccaaagacgttgcacgccaagagctgaacgtttttcggatgaaactcctcggc
gccaaagtccatgcggtcgagagcggttccaaaaccctcaaagacgcgatgaacgatgcg
atccgccactgggtcacccatgcacgcgataccttctatattatcggaaccgttgcggga
ccgcacccttatccgatgatggtacgcgattttcaggcgattatcggatgtgaagcccgt
gcgcagattttagagaaagaaaagcgtctgcccgattacgtcatcgcctgcatcggcggg
ggttcaaacgcgatcggaacttttcagcactttttggaagacaaagaggtacgctgtatc
gggatcgaagcgggaggattgggtgttgagacagacaaacacggatgttcgctcctcaaa
gggcgacccggggtactgcacgggcaaatgagctaccttctccaagacgaagacggacaa
atcctccaagcccactctatctcggcagggctggattacccgggtatcggtccggaacac
gcttttcacaaagacaacgacaccgtcagctacgacaatattactgatgatgaagcgctt
gatgctttcgtatggctcagccgccgtgaggggattatcccggcatttgaaagttctcat
gccgttgcctatctaaaaaagatgcccgacatcaaaggtaaactcgtcatcgtcaatctc
tccggccgaggagataaagatatgattcaggcaaaacaaattttaaatttcgataactaa

DBGET integrated database retrieval system