KEGG   Sulfuricurvum kujiense: Sulku_1566Help
Entry
Sulku_1566        CDS       T01370                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sku  Sulfuricurvum kujiense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulku_1566
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sulku_1566
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sulku_1566
Enzymes [BR:sku01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sulku_1566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1577766..1578965
Genome map
AA seq 399 aa AA seqDB search
MYIPSPSKFDPVDGHFGIFGGRYVPETLMPALLELEEAYKEIRFDETFWSEVDGYLRDYV
GRPSPLYYAANLSEELGAKIYLKREDLNHTGAHKVNNVIAQGLMAKRLGKKKVIAETGAG
QHGVATATIAALLGLECEIFMGAKDVARQELNVFRMKLLGAKVHAVESGSKTLKDAMNDA
IRHWVTHARDTFYIIGTVAGPHPYPMMVRDFQAIIGCEARAQILEKEKRLPDYVIACIGG
GSNAIGTFQHFLEDKEVRCIGIEAGGLGVETDKHGCSLLKGRPGVLHGQMSYLLQDEDGQ
ILQAHSISAGLDYPGIGPEHAFHKDNDTVSYDNITDDEALDAFVWLSRREGIIPAFESSH
AVAYLKKMPDIKGKLVIVNLSGRGDKDMIQAKQILNFDN
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtacatccctagcccttctaaatttgatccggttgacggacacttcggcatcttcgga
ggacgttatgtccccgaaacattaatgcctgctttgctggagcttgaagaagcctacaaa
gagatccgcttcgacgaaacattctggagcgaagtcgacggctatctgcgtgattatgtc
ggtcgtccgagtcctctgtattatgccgccaatctctccgaagagttgggagccaaaatc
tatctcaagcgggaagatttgaaccacacgggtgcccataaagtcaataatgtcattgcg
cagggattgatggcgaaacgtttgggcaagaaaaaagtgatcgccgaaacaggcgcgggt
cagcacggtgtcgctaccgcaacgatcgccgcacttttgggattggaatgcgaaatcttc
atgggagccaaagacgttgcacgccaagagctgaacgtttttcggatgaaactcctcggc
gccaaagtccatgcggtcgagagcggttccaaaaccctcaaagacgcgatgaacgatgcg
atccgccactgggtcacccatgcacgcgataccttctatattatcggaaccgttgcggga
ccgcacccttatccgatgatggtacgcgattttcaggcgattatcggatgtgaagcccgt
gcgcagattttagagaaagaaaagcgtctgcccgattacgtcatcgcctgcatcggcggg
ggttcaaacgcgatcggaacttttcagcactttttggaagacaaagaggtacgctgtatc
gggatcgaagcgggaggattgggtgttgagacagacaaacacggatgttcgctcctcaaa
gggcgacccggggtactgcacgggcaaatgagctaccttctccaagacgaagacggacaa
atcctccaagcccactctatctcggcagggctggattacccgggtatcggtccggaacac
gcttttcacaaagacaacgacaccgtcagctacgacaatattactgatgatgaagcgctt
gatgctttcgtatggctcagccgccgtgaggggattatcccggcatttgaaagttctcat
gccgttgcctatctaaaaaagatgcccgacatcaaaggtaaactcgtcatcgtcaatctc
tccggccgaggagataaagatatgattcaggcaaaacaaattttaaatttcgataactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system