KEGG   Sulfuricurvum kujiense: Sulku_1662Help
Entry
Sulku_1662        CDS       T01370                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sku  Sulfuricurvum kujiense
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Sulku_1662
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sulku_1662
Enzymes [BR:sku01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Sulku_1662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1674665..1675204)
Genome map
AA seq 179 aa AA seqDB search
MKKKWWLGAWVITVLALLLNAASIYKYEVKTLRNETTTLEPYRGKVLLIVNIASRCAYTP
QLGGLEKLYSTYSSRGFAVLGFPTNQFSSQEPLAGPELEKFCKLKYGVTFPIFGKIDVSG
VNINPLYHYLKNGISGVSQSEPIEWNFTKYLIDRNGFVLRKYSPRVKPEEIAADIEKFL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaatggtggcttggagcatgggtaattacagtacttgcattgttgctgaat
gccgcatccatttataaatatgaagtcaaaacacttcgcaatgagacaacaacactggaa
ccgtataggggaaaggtcttgttgatcgtcaatattgccagccgatgcgcttatacccct
caactcggagggcttgaaaagctgtacagtacatatagttcccgcgggtttgcggtactc
ggatttcctaccaatcagttttcatctcaagagccgttggcggggccggaacttgagaaa
ttctgcaagctcaagtacggggtaacgtttccgatattcggaaaaatcgatgtcagcggg
gttaatattaatccgctttaccattatctaaaaaacgggatatcaggggtaagtcaaagt
gaaccgatagagtggaattttaccaaatacctgatagatcgtaacggatttgtgcttcgc
aaatattctccgagagtaaaacccgaagagattgcagcggatatcgagaagtttttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system