KEGG   Sulfuricurvum kujiense: Sulku_1792Help
Entry
Sulku_1792        CDS       T01370                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sku  Sulfuricurvum kujiense
Brite
Enzymes [BR:sku01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Sulku_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1805806..1807020
Genome map
AA seq 404 aa AA seqDB search
MKAIVILTGLFSLTLLHANEALHQTALKHGLKPIPYSYTVAAEQNKRAELGKKLFFDKRL
SLNGDISCASCHSTKHGGADGRPTAIGDKGQSNPHHLNTPTVLNTTFSKHYFWDGRSASL
ADQAKGPLQAPFEMASNPKLIEKRLSKIPAYAHEFKKVFGDSSITFDRTVEAISAYEDTL
VTHGRYDRFLEGNLSALNENEQAGLNLFIQKGCIGCHNGIGLGGQEIRKFPLLHHPIWSM
AKQKKINALREKYLAFLSAPPSGALNRYDALIQTMGNDDTELLRLGYFEHYNQKESSRIM
SANGCFECHLDKTFKVENAILKRTAFAFENKGGFLGKEKPSRYFRVPLLRNVVRTAPYFH
NGNVATLKEAVQIMVKYQSRSSVTPQQLDQLIAFLKAVDAPIAK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctattgtgatacttacaggacttttttcactaacgctgcttcatgcaaacgaa
gccctgcatcagacggcgctaaaacacggtctcaaaccgataccctacagctacaccgtc
gcagcagagcaaaataagagagccgagttgggcaaaaagcttttttttgacaaacggtta
tcgctgaatggtgatatcagctgtgcaagctgccacagtaccaaacacggcggtgcggac
ggacgccctaccgccatcggagataaagggcaaagcaatccccatcatctcaatacccct
acggtattaaacacgacattttcaaaacactatttttgggacggacgaagtgcgagtctc
gccgatcaggcaaaagggccgcttcaagccccgtttgaaatggcatccaacccaaaactt
atcgaaaaaaggctctccaagatacccgcatatgctcatgaatttaaaaaagtgttcggc
gattcttctatcacatttgatcgaaccgtcgaagcgatcagcgcctacgaagatacactg
gtgacccacggacgctatgaccgttttttagaaggaaatctgagtgcgttgaatgaaaat
gaacaagcgggtctcaatctattcattcaaaaagggtgtatcggctgtcataacggaatc
gggttaggcggtcaggagattcgtaaatttcctctgctgcaccatccgatctggagtatg
gcaaagcagaaaaaaatcaatgcgctccgcgaaaaatatctcgcctttttatccgctccg
ccatccggcgcactcaaccgttatgacgccttgatccaaaccatggggaatgacgatacg
gagctgcttcgtctagggtatttcgaacattacaatcaaaaagagagcagccgtatcatg
agcgccaatgggtgcttcgagtgccatctggataaaacgttcaaagtcgaaaatgccatc
ttaaagcggacggcatttgcctttgaaaacaaagggggatttttggggaaagagaagccg
agccgttattttcgcgtcccgctgctgcgaaacgttgtccgaaccgctccgtattttcat
aacggcaacgtcgcgacactgaaagaagcggtgcagatcatggtcaaataccaaagccgt
tcatccgttacaccgcaacaactcgatcaactgatcgcatttttaaaagcggtagacgca
ccgatagcaaagtaa

DBGET integrated database retrieval system