KEGG   Sulfuricurvum kujiense: Sulku_1828Help
Entry
Sulku_1828        CDS       T01370                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku00010  Glycolysis / Gluconeogenesis
sku00620  Pyruvate metabolism
sku00640  Propanoate metabolism
sku00680  Methane metabolism
sku00720  Carbon fixation pathways in prokaryotes
sku01100  Metabolic pathways
sku01110  Biosynthesis of secondary metabolites
sku01120  Microbial metabolism in diverse environments
sku01130  Biosynthesis of antibiotics
sku01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulku_1828
   00620 Pyruvate metabolism
    Sulku_1828
   00640 Propanoate metabolism
    Sulku_1828
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Sulku_1828
   00680 Methane metabolism
    Sulku_1828
Enzymes [BR:sku01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sulku_1828
Lipid biosynthesis proteins [BR:sku01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sulku_1828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADR34488
UniProt: E4U1F1
Position
complement(1830382..1832340)
Genome map
AA seq 652 aa AA seqDB search
MSDIVKPTFHPNREFAKNARIKNMCEYHDLQAWAEEDYEGFWAHFANEKIDWFKPYTQVL
DESNAPFYKWFVNGKLNVAHQCIDRHLTSRKNKAAIIFEGDRGDKQIITYLELYYNVNKF
ANLLKNEFHVKKGDRVVIYMPMIPEAAYAMLACARIGAIHSIVFGGFSSEALKDRIEDAQ
AKLVITADGAYRKDKPYMLKPVVDQAIDANSPVEKVLVVERNNEDVTWVAGRDYSYNELI
KSQSSICEAEEMDAEDPLFLLYTSGSTGKPKGVQHNSAGYILWAQMTMEWVFDVKENDTY
WCTADVGWITGHTYIVYGPLAMGATTVMFEGVPTYPDAGRPWKMVEEYKINQFYTAPTAI
RVLHKTGEDEPSKYDLSSLKVLGTVGEPIDPPAWKWYYEAVGGSKCAIVDTYWQTETGGH
IVSPLPGATPIKPACATFPLPGIIAEILDPQTGVKVPAGEGGYMCVTRPWPSMIRGIWGD
PERFVKSYFGDVKKDGQPVYFTGDGAIYDEEGYITITGRTDDVINVSGHRMGTAEVEAAC
KKHPNVAEVAVVGKPHDIKGEGIFAYIVLKSEDTVGEEMEMVKEINKVIMKEIGNIAICD
DIVFVPGLPKTRSGKIMRRILRSIAKGDAITQDISTLEDPSIVATIEAKVKG
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatcgtcaaaccgacttttcatccaaaccgagagtttgctaaaaatgcacgc
attaaaaacatgtgcgaataccacgatttacaagcgtgggcagaggaagattatgaagga
ttctgggcccattttgccaatgaaaaaattgactggtttaaaccgtatactcaagttctc
gatgagagtaacgcaccgttttacaaatggttcgtgaacggaaaacttaacgttgctcac
caatgtatcgaccgtcacctcacttcacgcaaaaacaaagcggcgatcattttcgaaggc
gaccgcggtgacaaacaaattattacctatcttgaactttattacaacgtcaataagttc
gcaaacctccttaaaaacgagttccatgtcaaaaaaggcgaccgtgttgtaatctatatg
ccgatgatcccggaagcggcgtatgcgatgcttgcgtgtgcccgtatcggagcgatccac
tcgatcgttttcggcggattctcatccgaagcgctgaaagaccgtatcgaagatgcgcag
gctaaattggtaatcactgcagacggtgcataccgcaaagacaaaccgtacatgctcaaa
ccggtcgttgaccaagcgatcgatgccaattctccggtggaaaaagttctcgtggtcgag
cgtaacaacgaagacgttacctgggtagcgggacgcgattactcgtacaacgaattgatc
aaatctcaatcaagcatttgtgaagccgaagagatggatgcggaagatccgttgttcctc
ctctatacgtcaggttctaccggaaaaccgaaaggggtacaacacaactctgcggggtat
atcctttgggctcaaatgacgatggaatgggtattcgacgtcaaagaaaacgacacttac
tggtgtactgccgacgtcggctggattaccggacacacctacatcgtttacggaccgctt
gcaatgggtgcgacgacggtcatgttcgaaggagttccgacctatccggatgcgggacgt
ccgtggaaaatggtcgaagagtacaaaatcaaccaattctacactgctccgacggcaatc
cgcgtattgcacaaaacgggtgaagatgagccctctaaatacgatctcagcagcctgaaa
gtcctcggaaccgtcggtgagccgatcgaccctccggcatggaaatggtactatgaagcg
gtcggcggaagcaaatgtgcgatcgtcgatacctactggcaaaccgagacggggggacac
atcgtttctccgcttccgggggcaactccgatcaaacctgcgtgtgcgacattcccgctt
ccggggatcatcgctgagatccttgatccgcaaaccggtgtcaaagtaccggcgggcgag
ggcggttatatgtgtgtaacccgtccttggccgtcaatgatccgcggcatctggggcgat
cctgagcgtttcgtgaaatcgtacttcggcgatgttaaaaaagacggtcagccggtctac
ttcaccggtgacggcgcaatctacgacgaagagggctacatcacgattacaggacgtacc
gatgacgttatcaacgtatccggtcaccgtatgggaactgccgaagttgaagcggcatgt
aaaaaacaccctaacgttgctgaagtagccgttgtcggtaaaccgcacgatatcaaaggt
gaggggatcttcgcctacatcgttctcaaaagcgaagataccgtcggtgaagagatggag
atggtcaaagagatcaacaaagtgatcatgaaagagatcggtaacatcgctatctgtgat
gacatcgttttcgttccgggcttgccgaaaacacgttcaggaaaaatcatgcgccgtatc
ctccgctcaattgcgaaaggcgatgcgattactcaggatatctcgactctcgaagatccg
tcgatcgttgctactatcgaagcgaaagtcaaaggctaa

DBGET integrated database retrieval system