KEGG   Sulfuricurvum kujiense: Sulku_1849Help
Entry
Sulku_1849        CDS       T01370                                 

Definition
(RefSeq) UDP-glucose pyrophosphorylase (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sku  Sulfuricurvum kujiense
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sulku_1849
   00052 Galactose metabolism
    Sulku_1849
   00500 Starch and sucrose metabolism
    Sulku_1849
   00520 Amino sugar and nucleotide sugar metabolism
    Sulku_1849
Enzymes [BR:sku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sulku_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1853755..1854582
Genome map
AA seq 275 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVLTKPLIQYGVEEAVEAGMHTMAIVTGRGKR
ALEDHFDVSYELEHQIKGSDKEHYLTEIRSLIDQCTFSYTRQNEMKGLGHAILTGETLIG
NEPFAVILADDLCDGNSDGGVLSQMVELFNKYKCSIVAIEEIDPSHTNRYGIIEGKEIED
GVYMISNMVEKPDPANAPSNLAIIGRYILTPDIFGIIENTPAGKGGEIQITDALMTQAQK
GMVLAYKFKGKRFDCGSVEGFVEATNYFYEKSTEQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaagtgtcttttccctgctgccgggtacggtacccgctttttaccggcaacc
aaagcgatgcctaaagagatgctcccggtcctcaccaagcctttaatccaatacggcgtt
gaagaggctgtagaagcgggaatgcacacgatggccatcgttacgggacgggggaaaaga
gcattggaagatcattttgatgtcagttacgaacttgaacatcagatcaaaggttccgac
aaagagcattatctcaccgaaatccgttcccttatcgatcaatgtacgttttcgtacacg
cgccaaaacgaaatgaaagggcttggtcatgcgatattgaccggagagacattaatcgga
aatgaaccttttgccgttattttggccgatgatttgtgcgacggaaacagtgacggaggg
gttctttcccaaatggtcgaactatttaacaaatacaaatgctcgatcgtcgccatagaa
gagattgatccgagccatacaaaccgctacggcattatcgaaggaaaagagatcgaagac
ggtgtctacatgatttcaaatatggttgagaagcctgatccggccaatgcaccgagtaat
ctcgccatcatcgggcgctatatcctcacacccgatattttcgggattatcgaaaatacc
cctgccggtaaagggggagagatacaaattaccgatgcgctgatgacacaggctcaaaaa
gggatggtcttagcttataagttcaaaggaaaacgatttgactgcggaagcgtcgaaggg
ttcgtcgaagccaccaactatttctacgaaaaaagcaccgaacaataa

DBGET integrated database retrieval system