KEGG   Sulfuricurvum kujiense: Sulku_1849Help
Entry
Sulku_1849        CDS       T01370                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sku  Sulfuricurvum kujiense
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sulku_1849
   00052 Galactose metabolism
    Sulku_1849
   00500 Starch and sucrose metabolism
    Sulku_1849
   00520 Amino sugar and nucleotide sugar metabolism
    Sulku_1849
Enzymes [BR:sku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sulku_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1853755..1854582
Genome map
AA seq 275 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVLTKPLIQYGVEEAVEAGMHTMAIVTGRGKR
ALEDHFDVSYELEHQIKGSDKEHYLTEIRSLIDQCTFSYTRQNEMKGLGHAILTGETLIG
NEPFAVILADDLCDGNSDGGVLSQMVELFNKYKCSIVAIEEIDPSHTNRYGIIEGKEIED
GVYMISNMVEKPDPANAPSNLAIIGRYILTPDIFGIIENTPAGKGGEIQITDALMTQAQK
GMVLAYKFKGKRFDCGSVEGFVEATNYFYEKSTEQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaagtgtcttttccctgctgccgggtacggtacccgctttttaccggcaacc
aaagcgatgcctaaagagatgctcccggtcctcaccaagcctttaatccaatacggcgtt
gaagaggctgtagaagcgggaatgcacacgatggccatcgttacgggacgggggaaaaga
gcattggaagatcattttgatgtcagttacgaacttgaacatcagatcaaaggttccgac
aaagagcattatctcaccgaaatccgttcccttatcgatcaatgtacgttttcgtacacg
cgccaaaacgaaatgaaagggcttggtcatgcgatattgaccggagagacattaatcgga
aatgaaccttttgccgttattttggccgatgatttgtgcgacggaaacagtgacggaggg
gttctttcccaaatggtcgaactatttaacaaatacaaatgctcgatcgtcgccatagaa
gagattgatccgagccatacaaaccgctacggcattatcgaaggaaaagagatcgaagac
ggtgtctacatgatttcaaatatggttgagaagcctgatccggccaatgcaccgagtaat
ctcgccatcatcgggcgctatatcctcacacccgatattttcgggattatcgaaaatacc
cctgccggtaaagggggagagatacaaattaccgatgcgctgatgacacaggctcaaaaa
gggatggtcttagcttataagttcaaaggaaaacgatttgactgcggaagcgtcgaaggg
ttcgtcgaagccaccaactatttctacgaaaaaagcaccgaacaataa

DBGET integrated database retrieval system