KEGG   Sulfuricurvum kujiense: Sulku_1881Help
Entry
Sulku_1881        CDS       T01370                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sku  Sulfuricurvum kujiense
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sulku_1881
   01230 Biosynthesis of amino acids
    Sulku_1881
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulku_1881
   00030 Pentose phosphate pathway
    Sulku_1881
   00051 Fructose and mannose metabolism
    Sulku_1881
   00052 Galactose metabolism
    Sulku_1881
  Energy metabolism
   00680 Methane metabolism
    Sulku_1881
Enzymes [BR:sku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sulku_1881
Protein phosphatases and associated proteins [BR:sku01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sulku_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1886097..1887077
Genome map
AA seq 326 aa AA seqDB search
MNQKIAILCSGGDVSGMNPALKRFVEYAYARNLQPYFVRNGYEGLIDNHIVPADYHDVAG
IITRGGTKIGSARSLRFKEASYRAVAAENLRSHGIDRLIVLGGDGSFRGMERFYHETGIA
FCGIPSTIDNDINGTDYCLGVDTALGVIKDAIDQIRDTASSFHRAFVIETMGRDCGYLTL
ISAITSGAELCLIPELPVDIDDFKGCFQSQIAKGRDYFIAVVSEALDSKKVAEWFEKELG
FESRVSVLGHIQRGGNPSVYDRLMAFKFVTYAIDALLEGKNHSIICYNKSHFNFKTIDEV
ALHPYRLDEELLNLAREQFLPTRCQM
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaaaatagctattctctgctccggcggagatgtttcggggatgaatcccgca
ttgaaacgttttgtcgaatacgcctatgcccgtaatctccaaccctattttgtccgaaac
ggctacgaggggcttatcgacaatcatattgtccccgcagactatcatgatgtcgccgga
atcattacccgaggagggactaagatcggttcggcccgctcattacggtttaaagaggct
tcctatcgtgcggttgccgcagaaaatctcaggtctcacggcattgacagactgatcgta
ctaggaggagacgggagctttcgcggaatggaacgcttctatcacgagaccgggatagca
ttttgcggaattccctcaaccattgacaatgatatcaacggtaccgattattgtctgggg
gtcgatacggcgttgggagtcatcaaagatgcgattgaccagatccgtgacaccgcatcc
tcgtttcaccgggcattcgtcatcgagacgatggggcgcgactgcggctatcttactttg
atttccgccattacttcaggagcggagctatgtctgatccccgaacttccggtcgatatc
gatgacttcaaagggtgttttcaatcccagatcgccaaaggacgcgactatttcattgct
gtcgtatccgaagcgcttgatagcaaaaaagtggcggagtggttcgaaaaagagttggga
tttgaatcgcgtgtttcggtactgggacatattcagcgcggcggaaacccgagcgtatat
gaccggctaatggcctttaaattcgttacctacgcgatcgatgcactattggaagggaaa
aaccattccattatctgctacaacaaaagccatttcaattttaaaacaattgacgaagtc
gcattgcacccttaccgcctagatgaagaactccttaatctggcacgcgaacaatttctt
ccaacgcgctgtcaaatgtag

DBGET integrated database retrieval system