KEGG   Sulfuricurvum kujiense: Sulku_1881Help
Entry
Sulku_1881        CDS       T01370                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku00010  Glycolysis / Gluconeogenesis
sku00030  Pentose phosphate pathway
sku00051  Fructose and mannose metabolism
sku00052  Galactose metabolism
sku00680  Methane metabolism
sku01100  Metabolic pathways
sku01110  Biosynthesis of secondary metabolites
sku01120  Microbial metabolism in diverse environments
sku01130  Biosynthesis of antibiotics
sku01200  Carbon metabolism
sku01230  Biosynthesis of amino acids
sku03018  RNA degradation
Module
sku_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulku_1881
   00030 Pentose phosphate pathway
    Sulku_1881
   00051 Fructose and mannose metabolism
    Sulku_1881
   00052 Galactose metabolism
    Sulku_1881
  Energy metabolism
   00680 Methane metabolism
    Sulku_1881
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Sulku_1881
Enzymes [BR:sku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sulku_1881
Protein phosphatases and associated proteins [BR:sku01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sulku_1881
Messenger RNA biogenesis [BR:sku03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Sulku_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADR34541
UniProt: E4U1R8
Position
1886097..1887077
Genome map
AA seq 326 aa AA seqDB search
MNQKIAILCSGGDVSGMNPALKRFVEYAYARNLQPYFVRNGYEGLIDNHIVPADYHDVAG
IITRGGTKIGSARSLRFKEASYRAVAAENLRSHGIDRLIVLGGDGSFRGMERFYHETGIA
FCGIPSTIDNDINGTDYCLGVDTALGVIKDAIDQIRDTASSFHRAFVIETMGRDCGYLTL
ISAITSGAELCLIPELPVDIDDFKGCFQSQIAKGRDYFIAVVSEALDSKKVAEWFEKELG
FESRVSVLGHIQRGGNPSVYDRLMAFKFVTYAIDALLEGKNHSIICYNKSHFNFKTIDEV
ALHPYRLDEELLNLAREQFLPTRCQM
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaaaatagctattctctgctccggcggagatgtttcggggatgaatcccgca
ttgaaacgttttgtcgaatacgcctatgcccgtaatctccaaccctattttgtccgaaac
ggctacgaggggcttatcgacaatcatattgtccccgcagactatcatgatgtcgccgga
atcattacccgaggagggactaagatcggttcggcccgctcattacggtttaaagaggct
tcctatcgtgcggttgccgcagaaaatctcaggtctcacggcattgacagactgatcgta
ctaggaggagacgggagctttcgcggaatggaacgcttctatcacgagaccgggatagca
ttttgcggaattccctcaaccattgacaatgatatcaacggtaccgattattgtctgggg
gtcgatacggcgttgggagtcatcaaagatgcgattgaccagatccgtgacaccgcatcc
tcgtttcaccgggcattcgtcatcgagacgatggggcgcgactgcggctatcttactttg
atttccgccattacttcaggagcggagctatgtctgatccccgaacttccggtcgatatc
gatgacttcaaagggtgttttcaatcccagatcgccaaaggacgcgactatttcattgct
gtcgtatccgaagcgcttgatagcaaaaaagtggcggagtggttcgaaaaagagttggga
tttgaatcgcgtgtttcggtactgggacatattcagcgcggcggaaacccgagcgtatat
gaccggctaatggcctttaaattcgttacctacgcgatcgatgcactattggaagggaaa
aaccattccattatctgctacaacaaaagccatttcaattttaaaacaattgacgaagtc
gcattgcacccttaccgcctagatgaagaactccttaatctggcacgcgaacaatttctt
ccaacgcgctgtcaaatgtag

DBGET integrated database retrieval system