KEGG   Sulfuricurvum kujiense: Sulku_1935Help
Entry
Sulku_1935        CDS       T01370                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sku  Sulfuricurvum kujiense
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sku00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sku00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1942233..1943102
Genome map
AA seq 289 aa AA seqDB search
MKHLIRTDDFTIEQIIQVLHDAEHYLQGQFDPILKEKIIITLFFENSTRTKSSFEIAAKR
LGAEVVHLDVQKSSTQKGESLVDTAANLDAMGPHAMIVRHAHAGVPNILAEHTHASIINA
GDGAHAHPTQALLDLFTLRRHFGELKGKKIAIVGDIKNSRVANSNIELLTRFGMDITLVA
PPHFLPDSYLKMTHNLHDVIHNVDAIMSLRTQTERHSHQTYGSLKDYASDFCITKELVGE
RDIILLHPGPVHRNIDIDDMMLKDPRCKVLEQVRNGVAIRMAVLKALIA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacctgattcgcacggatgattttacaattgaacaaattattcaggttttacac
gatgcggaacattatcttcaggggcaatttgatcccattctcaaagaaaaaattatcatc
accctctttttcgaaaactcgacccgtactaaaagctcttttgaaatcgcagccaaacgt
ctcggagccgaggtcgtccatctggatgttcaaaaaagctcgacccaaaaaggggaaagc
cttgtcgataccgcagccaacctcgatgcgatgggccctcatgcgatgatcgtccgtcat
gcccatgcaggtgttcccaatatccttgccgaacatacccatgcttccataatcaatgcc
ggtgacggggcacacgcccatcccactcaggcacttctcgatctctttaccctccgccgt
catttcggtgagcttaaggggaaaaaaatcgccattgtaggggatatcaaaaattcccgt
gttgccaacagtaatatcgagttattgacccgcttcggaatggatatcactctggtagca
ccgccccattttcttcccgattcctatttaaaaatgacccataaccttcatgatgttatc
cataatgtcgatgcaatcatgagtctgcgtacccaaacggagcgccattcgcaccaaacc
tacggttcgcttaaagattacgccagcgatttttgcattaccaaagaacttgtcggagaa
cgagatatcatccttcttcatccgggtcccgttcatcgcaatatcgatatcgatgacatg
atgctcaaagatccgcgctgcaaagtgttagagcaggtacgtaacggggtcgcgattcgt
atggctgtccttaaagcgcttattgcttaa

DBGET integrated database retrieval system