KEGG   Sulfuricurvum kujiense: Sulku_1983Help
Entry
Sulku_1983        CDS       T01370                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sku  Sulfuricurvum kujiense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulku_1983
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sulku_1983
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sulku_1983
Enzymes [BR:sku01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sulku_1983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1999982..2000722)
Genome map
AA seq 246 aa AA seqDB search
MKKLVAYITAGYPDKNFTVDLALALGENGVDTLELGVPFSDPVADGPVIEAANQRALEGG
FRFADLLEISEKVAPKIDTLWMGYFNPFYQYGMEALLEKAKSISVNGMIIPDVPYEEARV
YHSLFENRGLANITFVAPTDGEERIAMITAEARKFIYLVAYAGITGSGKSEDLAPTLAMI
KRHTQTPVYVGFGVNEQTAREKVQGADGVIVGSAIVNVLLDDSLSNTQKIAKCCEITRKI
KSLINE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaactcgtagcatacattaccgcaggttatcccgataaaaactttaccgtagat
ttggctttggcgctgggcgaaaacggtgtcgatacccttgaactgggtgttccgttttct
gaccccgtcgcggacggtcctgtcatcgaagcggcgaatcagcgcgcactcgagggcggc
tttcggtttgccgatcttttggagatatctgaaaaagttgcgccgaaaatcgatacgtta
tggatgggatatttcaacccgttttaccaatacgggatggaagcgttgcttgagaaggcc
aaatcgatatccgtaaacggaatgattatccccgatgtgccgtatgaagaggcgagggtg
tatcactcgctctttgaaaatcgcggattggcgaacatcactttcgtcgctccgaccgac
ggcgaagagcgtatcgcgatgatcaccgccgaagcgcgcaaatttatctacctcgttgcc
tatgcggggattaccggaagcggtaaaagcgaagatttggctccgaccttagcgatgatt
aaacgtcatacgcagacgccggtgtatgtcgggttcggtgtcaacgagcagacggcccgt
gaaaaagtgcagggggcggacggtgttatcgtcggttcggcgattgtcaatgtccttttg
gacgatagcctctcgaatacccaaaaaattgctaaatgctgcgagataacccgtaagatc
aaatctcttattaacgaatag

DBGET integrated database retrieval system