KEGG   Sulfuricurvum kujiense: Sulku_1983Help
Entry
Sulku_1983        CDS       T01370                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sku  Sulfuricurvum kujiense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulku_1983
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sulku_1983
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sulku_1983
Enzymes [BR:sku01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sulku_1983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1999982..2000722)
Genome map
AA seq 246 aa AA seqDB search
MKKLVAYITAGYPDKNFTVDLALALGENGVDTLELGVPFSDPVADGPVIEAANQRALEGG
FRFADLLEISEKVAPKIDTLWMGYFNPFYQYGMEALLEKAKSISVNGMIIPDVPYEEARV
YHSLFENRGLANITFVAPTDGEERIAMITAEARKFIYLVAYAGITGSGKSEDLAPTLAMI
KRHTQTPVYVGFGVNEQTAREKVQGADGVIVGSAIVNVLLDDSLSNTQKIAKCCEITRKI
KSLINE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaactcgtagcatacattaccgcaggttatcccgataaaaactttaccgtagat
ttggctttggcgctgggcgaaaacggtgtcgatacccttgaactgggtgttccgttttct
gaccccgtcgcggacggtcctgtcatcgaagcggcgaatcagcgcgcactcgagggcggc
tttcggtttgccgatcttttggagatatctgaaaaagttgcgccgaaaatcgatacgtta
tggatgggatatttcaacccgttttaccaatacgggatggaagcgttgcttgagaaggcc
aaatcgatatccgtaaacggaatgattatccccgatgtgccgtatgaagaggcgagggtg
tatcactcgctctttgaaaatcgcggattggcgaacatcactttcgtcgctccgaccgac
ggcgaagagcgtatcgcgatgatcaccgccgaagcgcgcaaatttatctacctcgttgcc
tatgcggggattaccggaagcggtaaaagcgaagatttggctccgaccttagcgatgatt
aaacgtcatacgcagacgccggtgtatgtcgggttcggtgtcaacgagcagacggcccgt
gaaaaagtgcagggggcggacggtgttatcgtcggttcggcgattgtcaatgtccttttg
gacgatagcctctcgaatacccaaaaaattgctaaatgctgcgagataacccgtaagatc
aaatctcttattaacgaatag

DBGET integrated database retrieval system