KEGG   Sulfuricurvum kujiense: Sulku_2200Help
Entry
Sulku_2200        CDS       T01370                                 

Definition
AAA ATPase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sku  Sulfuricurvum kujiense
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sku03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2222897..2225137
Genome map
AA seq 746 aa AA seqDB search
MQILIGQIDRIIYQNNGFFIAVLKSGDKISAHYYESDVDHLANAAVTLKGSWEEHRQHGR
TFKAHTLIVNQNELFFFLNRVVKGFTKKLTAELIEKYGTDGLIEILDNDIERLMEIKGMN
EKRLLKLSDGWKQFRSMRLLGEFLAPFGVTPALLRLIAGAMKEIKNPIEAIKHNPYGLMR
INGIGFKKADEIALNMGLQSDDERRIQAAMEYTLSEYCEQEGNSCIERGALFNKLDLLVS
LGEHSKYGEALEDRLREGSITLLPSAKLSPTRIYEAELLLLNEFRGRGKTKNDPLTGDLE
SFLKTHSLNLGEQQLSALELINQGSGLIFLVGYAGTGKSTTAKALLDLLATRHEPSLIMT
CALSGIASQRIRERSGYQSATIQSLLVKFESHDTLPYQVILIDEASMINSTLFARLMAKI
ERSATVIIVGDDAQLPPIGAGSPLSDAIALNLAPAVMLTQIYRQREGQAIALIANDVRQG
IIPPYQKEYEDFTFIPVELSNRHALKRSLSDAEFDDAIHIQNNNLLAAIAEVTLKYLPHS
REKLQTKQIREYLNAFQVISPMRGNTLGVDNLNILLQEYFNPNAKKKIKTFKGEFRLHDK
VVHIKNENILSYTPEEFKEGIEPSERRIFNGMCGLVFRLDEDEELCYVFYPNEELIVQYK
YEQISDYLNLSYALSVHKVQGMEYERVVMVMSFSHHIMLNTKLLYTALTRAKGHCILVGE
GGAFESACRRLEHTKRTTVMQELRTN
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactcatcggccaaatcgatcgaatcatttaccaaaacaacggcttttttatc
gccgtccttaaaagcggcgataaaatcagcgcccattattacgaaagtgacgtcgatcat
ctcgcaaacgccgcagtcactctcaaaggctcatgggaagaacatcgccaacacgggcgg
acatttaaagcccatacgctgatcgttaaccaaaacgaactcttcttttttcttaatcgt
gtcgtcaagggatttaccaaaaagcttacggccgaattgattgagaaatacggtaccgac
ggactcatcgagattttagacaacgatattgagcgtctaatggagattaaagggatgaat
gagaaacgtctccttaagctctcggacggatggaaacagtttcgctcgatgcgtctgctc
ggagagtttctagcccctttcggcgttacccccgctttgcttcgactgatcgcaggagca
atgaaagagatcaaaaatcctatcgaagcgatcaaacataatccctacggattgatgcgt
atcaatggcataggatttaaaaaagccgatgagatagctttgaatatgggattacaaagc
gatgacgaacgtcgtatccaagcggcgatggaatatactctcagcgaatactgcgaacaa
gaggggaacagctgtatcgaacggggggcactgtttaacaaactcgatctgctcgtatcc
cttggagaacattccaaatacggcgaagctctggaagatcgtctccgtgaagggagcatc
acgctcctacctagtgcaaaactctcccctacccgaatttatgaggccgaattgctttta
ttaaacgaattcagagggcgggggaaaactaagaatgaccccttaaccggtgatctggaa
tcgttcttaaaaacccattcgctgaatcttggagaacagcagcttagtgcactggaactg
atcaatcaggggagcggattgatttttcttgtcggatatgcggggacgggaaaaagtacg
accgccaaagcgcttcttgatcttttggcgacacgtcatgagccgagtctcatcatgacg
tgtgccctgagcggtatcgcatctcagcgcattcgtgaacgcagcggctatcaaagtgcg
acgatccaaagcctgctggtcaaattcgaatctcacgacacgcttccttatcaggtgatt
ttgattgatgaggcctctatgatcaattcaaccctctttgcacgtctcatggcgaaaatt
gagcgttccgcaaccgtcattatcgtcggcgacgatgcacagctcccccctatcggagcc
ggaagccccttaagcgatgcgattgcattgaatctcgcccctgccgttatgctgactcag
atttaccgccaaagagagggacaagcgatagcacttatcgccaatgacgtccggcaaggt
attattcccccctaccaaaaagagtatgaagattttacctttatcccggtagagctctcc
aaccgccatgccctcaaacgctctttgagcgatgcggagttcgatgatgcgatccacatc
caaaacaacaatctcctagccgctatcgccgaagtgacgctgaaatatctcccccattca
cgtgaaaagctccaaaccaaacagatacgggaatacctaaacgcctttcaggtgatctct
ccgatgcgcggcaatacactcggagtcgataatctcaatattctccttcaagagtatttc
aaccccaacgcgaaaaaaaagatcaaaacattcaaaggtgaatttcggctccacgataaa
gtggttcatattaaaaacgaaaatatcctctcctacacacccgaagagtttaaagaggga
atcgaaccgagtgaacggcgaatttttaacggtatgtgcgggctcgtatttcggctcgat
gaagatgaggaactctgttatgtcttctaccccaatgaagagttgatcgtacagtacaag
tatgagcaaatcagcgattacctcaatctctcatatgctctgagcgttcataaagtacag
ggaatggagtatgagcgtgtcgtaatggttatgagtttttcacaccatataatgcttaat
accaaactcctctatacggcacttacacgtgcaaaagggcattgtatccttgtaggagaa
ggtggagcatttgagtcggcatgcagacgcttggaacataccaaacgtacaaccgtaatg
caggaattgcgaactaactaa

DBGET integrated database retrieval system