KEGG   Sulfuricurvum kujiense: Sulku_2201Help
Entry
Sulku_2201        CDS       T01370                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sku  Sulfuricurvum kujiense
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2225209..2226228
Genome map
AA seq 339 aa AA seqDB search
MKTLILSGIVATSVMGASLIDEAKNAGLKAIPANPKAVEKLTSNPKNPTTAAKVELGKML
YFEPRLSKSGLISCNTCHNLAIGGTDGMAAAIGHKWTSNPHGLSSPTVYNAVFYSQQFWD
GRSPHLEDQAQGPIQAGPEMAAPKDFVTGVVTSMPQYVSAFQSAYGKDIKITFEKIADTI
AVFERTLVTPSRYDAFLNGNKKALTQAEQKGLKTFIDKGCATCHNDIALGGTMQAFGVVA
PYKYMNVGDFKGDKNGMVRVPTLRNVTQSAPYFHNGQIATLPEAIKEMGRIQLGVNLNDE
EVTSIQTFLQSLEGKKPTIVYPMLPASTEKTPKVDVVNN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattgattctctctggcatcgttgccacctctgttatgggtgcttcactgatc
gatgaagctaaaaatgcgggactcaaagcgatccctgcaaatcccaaagcggttgaaaaa
ctcacttccaatcctaaaaatccgactacagcagccaaagtcgaactcggaaaaatgctc
tatttcgaaccgcgcctctccaaaagcggtttgatcagctgtaatacctgccacaatctt
gcaatcggcgggacagacggaatggctgcggccatcggacataaatggacctcaaacccg
cacggcctcagttcgccgaccgtctataacgccgtattctacagccagcaattctgggac
ggacgcagtccgcacctcgaagaccaagcccaaggaccgatccaggcaggacctgaaatg
gcggcaccgaaagatttcgtaaccggcgtagtcacttcaatgccgcaatacgtttccgca
ttccagagcgcatacggcaaagatatcaaaatcacgtttgaaaaaatcgccgatacgatc
gccgtattcgaacgtacgctcgtaacaccctcacgctacgatgcattcctcaacggaaac
aaaaaagcacttacacaagctgagcaaaaagggcttaaaacttttatcgacaaagggtgt
gcaacgtgtcataacgatatcgctctgggcggaaccatgcaggctttcggtgttgtcgct
ccatacaaatatatgaatgtaggcgatttcaaaggggacaaaaacggcatggtccgtgta
ccgacattgcgtaacgttacccaaagcgcaccgtatttccacaacggccaaatcgcaaca
ctccctgaagcgatcaaagagatggggcgcatccaactcggtgttaatttgaacgacgaa
gaagtgacatcgatccaaacgttcttacaatcacttgaaggaaaaaaaccgaccatcgtc
tatccgatgcttcccgcatcaacggaaaaaacacctaaagtcgacgttgtaaacaactaa

DBGET integrated database retrieval system