KEGG   Sulfuricurvum kujiense: Sulku_2331Help
Entry
Sulku_2331        CDS       T01370                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku00010  Glycolysis / Gluconeogenesis
sku00020  Citrate cycle (TCA cycle)
sku00620  Pyruvate metabolism
sku00633  Nitrotoluene degradation
sku00640  Propanoate metabolism
sku00650  Butanoate metabolism
sku00680  Methane metabolism
sku00720  Carbon fixation pathways in prokaryotes
sku01100  Metabolic pathways
sku01120  Microbial metabolism in diverse environments
sku01130  Biosynthesis of antibiotics
sku01200  Carbon metabolism
Module
sku_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
sku_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulku_2331
   00020 Citrate cycle (TCA cycle)
    Sulku_2331
   00620 Pyruvate metabolism
    Sulku_2331
   00640 Propanoate metabolism
    Sulku_2331
   00650 Butanoate metabolism
    Sulku_2331
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Sulku_2331
   00680 Methane metabolism
    Sulku_2331
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Sulku_2331
Enzymes [BR:sku01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Sulku_2331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_2 Fer4_10 Fer4_7 Fer4_17 Fer4_9 Fer4_8 Fer4_6 Fer4_13 Fer4_16 Fer4_4 Fer4_15 Fer4_3 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ADR34991
UniProt: E4TXQ5
Position
complement(2347241..2347660)
Genome map
AA seq 139 aa AA seqDB search
MEKKGWDGFEIGAMLRSFDGEIRDIATTLPENRPYSVSNSFTASVADWRIEKPLFNKDYC
IDCQFCWVYCPDMSIISRDKKMVGIDFDHCKGCGICVQVCPTNPKSLLMFPEQKDEEAAL
AEWPKKDTNKAHAEEAKED
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaaggatgggatgggttcgaaatcggtgctatgcttcggtcatttgacgga
gaaatacgcgatatcgcaacaacgcttccggaaaatcgcccttattctgtatcgaactcg
tttacggcaagtgtcgctgactggcgaatcgagaagcctttgttcaacaaagactactgc
atcgactgccagttttgctgggtatattgtccggatatgtcgattatttcacgcgataaa
aagatggtcggaatcgattttgaccattgtaaagggtgtgggatctgtgtgcaggtttgc
ccgaccaacccaaaatcgttattaatgttccctgaacaaaaagacgaagaagcagcactt
gccgaatggccaaaaaaagataccaataaagctcatgcagaagaagcgaaggaagactaa

DBGET integrated database retrieval system