KEGG   Sulfuricurvum kujiense: Sulku_2331Help
Entry
Sulku_2331        CDS       T01370                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
sku  Sulfuricurvum kujiense
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sulku_2331
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulku_2331
   00020 Citrate cycle (TCA cycle)
    Sulku_2331
   00620 Pyruvate metabolism
    Sulku_2331
   00640 Propanoate metabolism
    Sulku_2331
   00650 Butanoate metabolism
    Sulku_2331
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Sulku_2331
   00680 Methane metabolism
    Sulku_2331
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Sulku_2331
Enzymes [BR:sku01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Sulku_2331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2347241..2347660)
Genome map
AA seq 139 aa AA seqDB search
MEKKGWDGFEIGAMLRSFDGEIRDIATTLPENRPYSVSNSFTASVADWRIEKPLFNKDYC
IDCQFCWVYCPDMSIISRDKKMVGIDFDHCKGCGICVQVCPTNPKSLLMFPEQKDEEAAL
AEWPKKDTNKAHAEEAKED
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaaggatgggatgggttcgaaatcggtgctatgcttcggtcatttgacgga
gaaatacgcgatatcgcaacaacgcttccggaaaatcgcccttattctgtatcgaactcg
tttacggcaagtgtcgctgactggcgaatcgagaagcctttgttcaacaaagactactgc
atcgactgccagttttgctgggtatattgtccggatatgtcgattatttcacgcgataaa
aagatggtcggaatcgattttgaccattgtaaagggtgtgggatctgtgtgcaggtttgc
ccgaccaacccaaaatcgttattaatgttccctgaacaaaaagacgaagaagcagcactt
gccgaatggccaaaaaaagataccaataaagctcatgcagaagaagcgaaggaagactaa

DBGET integrated database retrieval system