KEGG   Sulfuricurvum kujiense: Sulku_2332Help
Entry
Sulku_2332        CDS       T01370                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
sku  Sulfuricurvum kujiense
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:sku01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sku00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sku00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sku00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sku00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sku00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sku00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:sku00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:sku00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2347671..2348228)
Genome map
AA seq 185 aa AA seqDB search
MLEIRWHSRAGQGAVTGAKGLADVVSTTGKHVQAFAFYGSAKRGAAMTAYNRVDDKVILN
HEKYMKPDYVLVIDPALVYVADITANEKPDTVYIITTHMSTEELIASQPKLAGKKVYTVD
CIKISQETIGKAIPNTPMLGALMKISGMYDMEFFKENMIRVLKKLPQKIIDANMIAIQRA
YDEVK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgctagagattcgatggcatagtcgagctggacaaggtgccgtaacaggcgcaaaaggt
ctagccgatgttgtatccaccaccggtaagcatgtacaggcatttgcgttttacggttca
gctaaacgtggagctgcaatgacggcgtataaccgcgttgatgacaaagtcatcttaaac
cacgaaaaatatatgaaaccggattacgtcttggtaattgaccctgcccttgtttacgtt
gcagatattactgcgaacgaaaaaccggatacggtttatattattacgacccatatgagt
acggaggaacttatcgcttcacagccgaaattggcagggaaaaaagtttacacggtagac
tgtatcaaaatttctcaggaaacgatcggaaaagcgatcccgaatactccgatgttgggc
gcattgatgaaaatatccggaatgtatgacatggagttttttaaagaaaatatgattcgt
gtacttaaaaaattacctcaaaaaattattgatgccaacatgatcgcgatccaacgcgct
tatgatgaagtaaagtaa

DBGET integrated database retrieval system