KEGG   Sulfuricurvum kujiense: Sulku_2384Help
Entry
Sulku_2384        CDS       T01370                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sku  Sulfuricurvum kujiense
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sku00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2397712..2399370
Genome map
AA seq 552 aa AA seqDB search
MCGIAGFISKNKDYNAQKIVQEMLDRGVHRGPDQSGLATYQDTTIGMVRLSIIDTVEHTI
PYEDSSGNFAIVYNGEIYNHQEIRKNLKYYTFLTNSDTETAMVSFIDKGINAFKEYNGMY
AFALHDKKKNETYIVRDKVGEKPLYYVKTKDFFAFASEIKSLMGLVEPKLNDKAVSYRAY
EFTTGKETLFKDIYLLEPGEYIHVKNNKATIKSYWKIWDHPIDVPDNEAKILSSLAELVE
DSILLRTQNSAHAFGAFVSGGIDSSLVACIAKPDHLYTAHYDYSDFNELDYAKLVAKQLK
KKLIIVEPTKDDFLRTQEQIAYHLDTPCTWTSFTLWALMERISQDGLKVMLTGDGADEVF
GGYHRYHLLHHDEQIHTLEAMKEYSYLINRYYGSPVERYTKLVNRSENPYDTKVLKFLNE
SIGFYFEKMQKDVVHAMGLNDFYSTMQVLLQMSDRVSMAFSIENRSPFLDYRLIQFAFSM
PSKYKIKNGITKWALKEVARKFIPKEICDRVDKRGFSAPVNKWFEWDKNGKYNRSAYKNI
SFDNWKKVYGVH
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagccggttttatcagcaaaaataaagattacaatgcacaaaagatcgtc
caagagatgttggatcggggcgtacatagggggcctgaccaatccggattggcaacgtat
caagacaccactatcggtatggtcaggctctccatcatcgataccgtcgaacacactatc
ccctatgaagacagcagcggcaattttgcaatcgtctacaacggtgaaatttacaaccac
caagagatccgaaaaaatcttaaatactatacttttttgaccaattctgacaccgaaaca
gcaatggtaagcttcatcgacaaagggatcaacgcttttaaagaatacaacggcatgtat
gcattcgcactgcatgataaaaagaaaaacgaaacctatatcgtacgggacaaggtggga
gaaaaaccgctctactacgtcaagactaaagattttttcgcatttgccagcgaaatcaaa
tctcttatggggctagttgaaccgaaattgaacgataaagcggtctcctacagagcctat
gaattcacaacaggcaaggagacccttttcaaggatatctatctccttgagccgggtgag
tatatccatgtcaaaaacaataaagccaccatcaagagctattggaaaatatgggatcac
cctatcgatgttccggataacgaggcaaaaattctgagttctcttgccgaattggtcgaa
gattccatcctgctccgaacacaaaacagcgcccatgcgttcggagcgttcgtcagcggt
gggatagacagttctttggtagcgtgcatcgccaaaccggatcatctttatacggcacat
tacgattacagcgactttaatgaactcgattacgccaaactcgtcgccaagcagctcaag
aaaaagcttatcattgtcgaaccgaccaaagacgatttcctccggacccaagaacagatc
gcttaccatttggacactccctgcacctggacgagctttactctatgggcgctgatggag
cggatcagccaagacggtctcaaagtgatgttgaccggagatggggcggatgaagtattt
ggagggtatcatcgatatcacctactccatcacgatgaacagattcatactctcgaagcg
atgaaagagtacagctatttaattaaccgttattacggctcgccggttgaacgttatacc
aagctcgtcaaccgctcggagaacccgtatgacacgaaggtgctgaaatttttaaacgaa
agcatcggattctattttgaaaagatgcaaaaagacgttgtccacgccatggggctcaac
gatttttacagtacgatgcaggtgctgctgcagatgtccgatcgggtttccatggcgttc
agtatcgaaaaccgttcgccgtttctggattatcggctgattcaattcgctttctcgatg
ccgtccaaatacaaaatcaaaaacggcattacgaaatgggcactcaaagaggtagcccga
aaatttatccccaaagagatatgcgaccgtgtggacaaaaggggattttcagctccggtc
aacaaatggttcgaatgggataaaaacggaaaatacaatcgaagcgcctacaaaaacatc
tctttcgacaattggaaaaaggtatatggagttcactga

DBGET integrated database retrieval system