KEGG   Sulfuricurvum kujiense: Sulku_2405Help
Entry
Sulku_2405        CDS       T01370                                 

Definition
hypothetical protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sku  Sulfuricurvum kujiense
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Sulku_2405
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sulku_2405
Enzymes [BR:sku01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Sulku_2405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2418304..2418726
Genome map
AA seq 140 aa AA seqDB search
MDGVILTPLKRIPHPKGDVYHALKQSDNGFHAFGEAYFSTVRQNCIKGWKKHTKMTLNLI
VPVGSIEFVLFDDRADSSTKGKFFATVLGPSAYQRLSVPPNVWMAFLGLEEFNLLLNVAD
LEHDPAEALTLELDAIAYEW
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggacggagtgatcctcacccccctcaaacgtatccctcatcccaaaggggatgtgtat
catgcactcaaacaaagcgataacggttttcatgctttcggcgaagcttatttttcaacc
gtccgtcaaaactgcatcaaagggtggaaaaaacatacgaaaatgacccttaacctgatc
gtcccggtcggatctatcgaattcgtcctttttgacgacagagcagattcttccacaaaa
gggaaattttttgccaccgttttgggtccaagcgcctaccagcgcctgagcgttcctccg
aatgtgtggatggcgttcctgggattggaagaatttaacctgcttttgaatgttgccgat
ttggaacatgatccggccgaagcccttactcttgagctggatgcgatagcctatgaatgg
taa

DBGET integrated database retrieval system