KEGG   Sulfuricurvum kujiense: Sulku_2537Help
Entry
Sulku_2537        CDS       T01370                                 

Definition
protein-l-isoaspartate o-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sku  Sulfuricurvum kujiense
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2562916..2563560
Genome map
AA seq 214 aa AA seqDB search
MSIDRITIIKTTRMADEIAKKFPLRPIVKNAIIHTNREAFVPLAMRHNAYRLDALPIGAQ
QYISSPLTVAKMTQYLSPEGCDNVLEIGCGSGYQAAVLSKVFRRVFTIERIESLLLEAKE
RFRHLHLMNIHTRTDDGQNGWEQYAPYDRILFSASARSIPQKLFDQLREGGILLAPVEKG
REQIITRFTKQGGKIHEDPLEVCDFVPVLDGVVR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgatagaattaccattattaaaaccacacggatggccgatgaaatcgccaaa
aaatttcctctccgtcctatcgtcaaaaacgcgatcatccataccaatcgcgaagccttt
gtcccccttgctatgcggcataacgcctatcgcctcgatgctctcccgatcggtgcccag
caatacatctcctcacccctgacggtagccaaaatgacgcagtacctcagcccggagggg
tgtgataacgtattggaaattggctgcggaagtggttatcaagccgcggttctctccaaa
gttttccgccgcgtctttaccattgagcggatcgaatcgctccttttagaggctaaagag
cgctttcgccatcttcacttgatgaatatccatacccgtaccgatgacggtcaaaacgga
tgggaacaatatgccccgtatgatcgtattttgttttcggcatcggcacgttctattccc
caaaagcttttcgatcagctccgagaggggggaatattattagctcccgtcgaaaaagga
cgcgaacagatcatcacccgttttacgaagcaaggcggcaaaatacatgaagacccattg
gaagtgtgcgatttcgtccctgtacttgatggtgtagtgcgatga

DBGET integrated database retrieval system