KEGG   Sulfuricurvum kujiense: Sulku_2659Help
Entry
Sulku_2659        CDS       T01370                                 

Definition
phospholipase A(1) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
sku  Sulfuricurvum kujiense
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sulku_2659
   00565 Ether lipid metabolism
    Sulku_2659
   00590 Arachidonic acid metabolism
    Sulku_2659
   00591 Linoleic acid metabolism
    Sulku_2659
   00592 alpha-Linolenic acid metabolism
    Sulku_2659
Enzymes [BR:sku01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Sulku_2659
    3.1.1.32  phospholipase A1
     Sulku_2659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSULKU01:complement(106892..108034)
Genome map
AA seq 380 aa AA seqDB search
MKKLIISMVTVRLFAGEYEEGLTLYHDGNYPSAVTHLTKAANDGNQYAQYALGKMYEEGL
GVDVNISQAKYWYKQSASSYQFPTAVVSNDKPMQQTQLYQIDPQSDAALHRFVNQYIDIP
KDADERETMLSKFFGNFGMLPYEKTFLIPIAYTTQNYEKRDSIIYPGYSEFNNNIETEFQ
ISLKKNLTYDLLKLNEIIGFGYTQEVWWQFYSDSAPFRETNYRPEIWMVIPVENEIFQNI
GLKAFKVAFWHESNGLGEPLSREWNQIYLDSIFYYGNLITTLRIWYPDEGNNNKDITDYL
GYGHLNLNYIIGKHQFDLTWRNNLHFNGDNRGSIEGEWSYPIGQSKNNFWYIKAYSGYGA
SLMDYNHPQNRFGFGFLFSR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgattatatcgatggttactgtccgtctctttgcaggagaatatgaagaa
gggttgacactctaccatgacggaaattacccctcagcggttacacatctgacaaaggcg
gcaaatgacgggaaccaatatgctcaatatgctcttggaaaaatgtacgaagaaggctta
ggcgtagatgttaatatctcacaagccaagtattggtacaaacaatcagcctcatcttat
caatttccgacagcagtagtatccaacgataaaccgatgcaacaaacacagttgtatcag
attgacccgcaaagtgatgcagcgcttcatcgttttgtgaaccaatatatcgacattcca
aaagatgccgatgaacgtgaaacaatgctgtctaaattttttggtaacttcggaatgctt
ccgtatgaaaaaacttttctcatacccatagcctatacgacacaaaattacgaaaaacgt
gattctattatttatcctggatatagtgagtttaacaataatattgaaacagaatttcag
atcagtttgaaaaaaaatctaacatatgatttgctaaaactgaacgaaattatcggtttt
ggatacacacaagaagtgtggtggcagttttattctgattcagcaccgtttcgtgaaaca
aattatcgtcctgaaatatggatggtgataccagtggaaaacgaaatatttcaaaatatc
ggactaaaagcatttaaagtcgctttctggcatgaatccaatggtttaggggaaccttta
tcgagagaatggaatcagatttatctcgattccatcttttattacggcaatttgattaca
accctcagaatctggtatccggatgaaggaaacaataataaagatatcaccgattacctt
gggtatggacacttaaatcttaactatattatcggaaagcaccagtttgatctgacgtgg
cgcaataacctccatttcaacggtgataatcgtggatcaatagaaggagaatggtcttat
cctatcggtcaatcgaaaaataatttctggtatattaaagcctatagcggttatggagca
agtctgatggattataatcatccccaaaaccgtttcggttttggatttctgttttcacga
tga

DBGET integrated database retrieval system