KEGG   Serpula lacrymans: SERLADRAFT_456050Help
Entry
SERLADRAFT_456050 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
sla  Serpula lacrymans
Pathway
sla00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:sla00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SERLADRAFT_456050
Enzymes [BR:sla01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     SERLADRAFT_456050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 18817258
NCBI-ProteinID: XP_007313108
JGI: 456050
UniProt: F8NFI0
Position
Unknown
AA seq 327 aa AA seqDB search
MSFIRAATVARSLAANARRYSAEAAAPKKSSKLPLYFGGAGIVGLGAYVYLGGSEPKVAK
KVQETSPLDPQKFVDFKLKKVEPYNHNTAKFIFELPDGQASLLPVASCLYVKAADPDALK
DDKGKPIYRPYTPISHPDQEGELTLLVKKYETGNASKYFFTLKPGDKMSFKGPLPKWPYK
INEFEEVGLIGGGSGITPLYQVLAHALADNTNKTKFKLLFANVTEQDILLREEFDALKKK
HPNNFDVVYVLDKPPANWKGPSGFITADLIKQHIAPPSLGDKVKIFICGPPPQVAAISGN
KTGIKSQGPLTGALKELGYNEDQVFKF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcatacgcgccgctaccgtagcacggtctttggctgcaaacgctcgccggtat
tccgctgaagctgcagcgcccaaaaaatcgtccaaacttcctctgtattttggtggtgct
ggaattgttggtctcggtgcctacgtttatctcggaggcagtgaacccaaagtagcgaag
aaagtgcaggagacaagccctcttgatccacagaaattcgtggacttcaagctcaagaag
gtcgaaccgtacaaccacaatacagcgaaattcatctttgagcttcctgatggccaagcc
tctttgcttcccgtggcttcgtgtctctatgtcaaggctgctgaccccgacgctctgaag
gatgacaaaggcaagcctatataccgcccatatacccccatctcgcacccagaccaggag
ggagaacttacccttctcgtgaagaagtacgagaccggcaatgcgtcgaaatacttcttc
accttgaagcctggagacaagatgtccttcaaaggtcctcttccgaaatggccttataag
ataaatgaatttgaggaggttgggttgattggtggaggaagcggaatcacgcctttatac
caagttcttgctcatgcacttgctgacaacaccaacaagacgaagttcaagttgcttttc
gccaatgtcacggaacaggatatccttcttcgcgaggaattcgacgcactgaagaaaaag
caccctaataacttcgatgtcgtttatgttcttgacaaaccccctgctaactggaaaggc
cccagcggttttattactgcagacctcattaagcagcacattgcacctccgtcgttggga
gacaaagtaaagatctttatctgtggtcctcccccacaagttgctgcgatatctggaaac
aagaccggtatcaaatcgcaagggccattgactggggctttgaaggagctgggctacaac
gaggaccaggtcttcaaattctga

DBGET integrated database retrieval system