KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_00232Help
Entry
SLGD_00232        CDS       T01177                                 

Definition
dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLGD_00232
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLGD_00232
   00020 Citrate cycle (TCA cycle)
    SLGD_00232
   00620 Pyruvate metabolism
    SLGD_00232
Enzymes [BR:slg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SLGD_00232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
248698..249987
Genome map
AA seq 429 aa AA seqDB search
MSQNIIMPKLGMTMTEGTVEEWFVAEGDDVNEGDSIATISSEKLTQDIEAPATGTLLKIE
VQAGEDAKVKGVLGIIGDADEATDNSSSSTESTNETADTSEHDQHETSTETAKDDAQSYS
TEKSTADVEKSPQHTRIFISPLARNMAEDKALDINRIKGTGGNARITKLDIQRVEAQGYD
YDDSKATETSVQTSKNVDVTNIGEGLNPMRKRIAQNMRESLANTAQLTLHRKVDADRLLD
FKDKLTVELNQADKDVKLTVTALLAKAVVLALKDYGAMNARYDNGELLEYEDVHLGIATS
LEEGLMVPVINEADTKSIGALAEEIKKTSQAVRDGHTDDVQLSGATFTITNMGTSGIEYF
TPILNLGETGILGVGALMKEVTLDGDSLRQVSRIPLSLTFDHQILDGAGAAEFLKVLAKY
IENPYLLIL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaatatcattatgccaaagctaggtatgacaatgacagaaggtactgtagaa
gaatggtttgtcgctgaaggtgatgatgtcaacgaaggtgatagtatagcaaccattagc
tcagaaaaattaacccaagatattgaagcgccagcgacaggaacattgctaaaaatcgag
gttcaagcaggagaagatgctaaagttaaaggtgttcttggaatcattggtgatgcagac
gaagctacagataatagctcaagttcaactgagtcaacaaatgaaactgcagatacatca
gaacatgatcagcatgagacgtcaacggagacagcaaaagacgatgctcaatcttattca
acagaaaaatcaactgcagatgtggaaaaatcaccacaacacacgcgtatctttatttca
ccacttgcacgcaatatggctgaagacaaagcgttagatattaatcgcataaaaggcaca
ggtggaaatgcacgtattaccaaattagacattcaacgcgtagaagctcaaggttatgat
tacgatgacagtaaagctactgaaacatcagtccaaacaagtaaaaacgttgatgttact
aatattggagaaggattaaatccaatgcgtaagcgcatcgcacaaaatatgcgtgaaagt
ttagctaacacagcccaattaacattacatcgcaaagtagatgccgatcgtctacttgat
tttaaagacaaattaaccgttgaattaaatcaagcagataaagatgtgaaattaactgta
actgcactcttagctaaagcagttgtacttgccttaaaagactatggcgcaatgaatgca
cgctatgacaatggtgagctattggaatatgaggatgttcatttaggtattgcaacatca
ttagaagaagggctaatggtacctgttattaatgaagctgatacgaaaagcattggtgca
ctcgctgaagaaattaaaaaaacatctcaagccgtacgtgatggtcacacagatgatgtt
caattgagtggtgcaacattcaccatcacgaatatgggtacaagtggtattgaatacttt
acccctattcttaatctaggagaaacagggattttaggtgttggtgcattgatgaaagaa
gtcacattagatggtgatagtttgagacaagtgtcacgtattcctttaagtttaactttc
gatcatcaaatattagatggcgcaggcgctgcagagttcttaaaagtattagcaaaatat
atcgaaaatccatatttacttattttataa

DBGET integrated database retrieval system