KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_00339Help
Entry
SLGD_00339        CDS       T01177                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SLGD_00339
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SLGD_00339
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SLGD_00339
Enzymes [BR:slg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SLGD_00339
Exosome [BR:slg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SLGD_00339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(355437..356885)
Genome map
AA seq 482 aa AA seqDB search
MRVFNKIGKATLATTIAAAALLSTSQLSEASGSGEGPANPQNDMMAMGNTKNPKNVIFMV
GDGMGPAYNTAYRYYADNPKTKELDQTAFDKYLKGTNRTNPDDPKENVTDSAAGGTAFAT
GHKTYNGAISVDTNKKPLKSVLEQAKENGKSTGLVTTAEVTDATPAVYAAHIDSRDKKDE
IAQQFYNDKINGQHKVDVILGGGSKYFGKNNGNLTKKFQNDGYDYVTNKTDLAHSQSNQV
LGLFAEKDMPLQIDAPQQNPLLVDMENSALSKLEKNNKGFFLMVEGASIDKSGHPNDITG
VMSEMSGFDKAFQNAINYANTHKDTLVVATADHSTGGLSIAKGKDYVWNPEAIRKMKHSG
SYMTKQIADGKDPETVIKEGYGINFPDNQLDKVKEAAKELKEVKSKVKNEKDPKLAAATT
KLQDAIQKPINDESHTGWTTYGHTGEDVNTYAYGPGEDKFLGNKDNTDSAKNIFAFLANN
AN
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtattcaataaaataggaaaagctacattagctacaacaatagcagctgccgca
ctcttaagtacgagtcaactatccgaagcatctggaagtggtgaaggtccagccaatccc
caaaatgatatgatggcgatgggtaacacgaaaaaccctaaaaacgtcatctttatggtc
ggcgatggtatgggccccgcttataacacagcttaccgttactatgcagataacccaaaa
acaaaagagttagatcaaactgcctttgataaataccttaaagggactaaccgtacaaat
cccgatgatccaaaagaaaatgttacagactctgccgctggtggtacagctttcgctact
ggacataaaacttacaatggcgccatttcagttgacacgaacaaaaaaccacttaaatct
gtactagaacaagctaaagaaaatggcaaatctacaggcttagtgacaacagctgaagtt
acagatgcgacaccagccgtttatgctgcacacattgacagtcgagataaaaaagacgag
attgcgcaacaattttataatgataaaattaatggccaacacaaagtagatgtcatctta
ggcggtggttctaaatactttggtaaaaacaatggtaatttaactaaaaaattccaaaat
gatggctatgattatgtcacaaataaaacagacttagcacattctcaaagcaatcaagta
ttaggcttatttgctgaaaaagatatgcccctacaaatagatgcacctcaacaaaatcca
ttattagttgatatggaaaatagtgcattatctaaacttgaaaaaaataataaagggttc
ttcttaatggttgaaggtgcctctattgataaatctggtcaccctaacgatattactggt
gtgatgtctgaaatgagcggatttgataaagcattccaaaatgcaatcaactatgccaac
acacataaagatacattagttgtagctacagcagatcattcaactggtggtttatctatt
gcaaaaggtaaagactatgtgtggaatccggaagcaatacgtaagatgaaacattctggt
agctatatgacaaagcagattgctgatggcaaagatcctgaaaccgtcattaaagaaggc
tatggcatcaacttcccagataatcaattagataaagtcaaagaagcagcaaaagaactt
aaagaagttaaatcaaaagtgaaaaatgaaaaagatccaaaacttgctgcagcaacgacg
aagttacaagatgcaattcaaaaaccaattaacgatgaatcacatactggttggacaact
tacggtcatactggagaagatgtgaatacttatgcttacggcccaggtgaggacaaattc
ttaggtaataaagataacacagatagtgcgaaaaatattttcgccttcttagctaataat
gctaattaa

DBGET integrated database retrieval system