KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_00363Help
Entry
SLGD_00363        CDS       T01177                                 

Definition
acetylornithine deacetylase (EC:3.5.1.16)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SLGD_00363
  Amino acid metabolism
   00300 Lysine biosynthesis
    SLGD_00363
Enzymes [BR:slg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SLGD_00363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
394271..395491
Genome map
AA seq 406 aa AA seqDB search
MTVLSEQERIDILADIVNINTENNNEIEVCYYLKELLQRYDIESKIIEIEGKRSNLVAEI
GSGRPVIGISGHMDVVDAGDEAQWMYPPFELHEQDGKLYGRGTSDMKGGLAALVIAMIEI
KASNLLQQGTIRLLATAAEEKEMSGSMLFRDKGYVDDLDGLIIGEPSDHYINYANKGSMG
IKIKAKGVAAHSSLPNLGHNAIDDIIRYIQKIKEKYEDIKNNDNKHSLDVSPLIKDYFGD
KFNDKELRKLENVAEGLVIVNSIIYGGEQFNTVPESAYAEFNIRTIPEYDNEAIIQLFEE
TLYEVDQAQLSMEITTNHAPVYSNKDNLLVKSFTEYKDDLTVTALVGATDASELLKGIDN
VDLTIIGPGFMRQAHRANEYIDKQHYLDFIDLYQHVIVDYLNKKSN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgactgttttgtctgaacaggaaagaatagatattttagcagacatcgttaatatcaat
acagagaataataatgaaatcgaggtttgctactatttgaaagaattactacaacgttat
gacattgaatcaaaaataattgaaattgaaggtaaacgttcaaatttagtagctgaaatt
gggtcaggtagacctgtcattggtatatctggacatatggatgttgtagacgcaggtgat
gaagcgcaatggatgtatcccccgtttgaattacatgagcaagatgggaaattatatggg
cgtggtacatctgatatgaagggcggccttgctgcgttagtcattgctatgatagaaata
aaagcttctaatttgttacaacaaggtaccatccgtcttttagcaacagcagctgaagaa
aaagaaatgtcaggatcaatgttatttcgtgataaaggttacgttgatgatttggatgga
ttgattattggtgaaccaagtgatcattatataaactatgctaacaaaggttcaatgggt
attaaaattaaagctaagggtgttgccgcgcatagttcgttacctaatttaggacataat
gcaatagatgacataattagatatatacaaaaaatcaaagaaaaatatgaagatattaaa
aataatgataataaacattcattagacgtatcaccgctaattaaagattactttggtgat
aagtttaatgataaggagcttagaaaattagaaaatgttgctgagggtttagttatagtt
aactcaattatttatggtggggaacagtttaatacagtacctgaaagtgcatatgcagaa
tttaatatacgtacaattccagaatatgataatgaagcaatcatacaattgtttgaagaa
actttgtatgaagtggatcaggcacaattatcaatggaaatcactacgaatcatgcccct
gtttatagcaacaaagataatttgttagtgaagtcatttactgaatataaagatgattta
acagttacagcgcttgtcggtgcgacagatgcatcagaattattaaaaggtatagataat
gtagacttaaccattatcggtcctggttttatgcgacaagcacatcgagcgaatgaatat
atagataaacagcattatttagattttattgatttgtatcaacatgtcattgttgattat
ttaaacaaaaagagtaattaa

DBGET integrated database retrieval system