KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_00376Help
Entry
SLGD_00376        CDS       T01177                                 

Definition
acyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLGD_00376
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLGD_00376
   00620 Pyruvate metabolism
    SLGD_00376
   00640 Propanoate metabolism
    SLGD_00376
  Energy metabolism
   00680 Methane metabolism
    SLGD_00376
Enzymes [BR:slg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SLGD_00376
Lipid biosynthesis proteins [BR:slg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SLGD_00376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
410610..412202
Genome map
AA seq 530 aa AA seqDB search
MKQSSLLAPETYNIVSEIEKHVSDQDKNAIIYENGHNDPIAVTYADLMKQANQVGHVLLN
HGLKKGDKILIMMPRSISTYRIYIAALKLGIAIIPSSEMLRTKDLQYRISHGEIDAVITM
PEFIKEFLNIEEYTSLTKFVVAGHHEAWISIDDERLNQSEELDMAPTSRDDIAILSYTSG
TTGNPKAVTHTHGWGFAHMKMAPKHWLSIKEDDLVWATAAPGWQKWVWTPFLSIMGSGAT
AFVYNGKFNPTRYLELLQNFKINVLCCTPTEYRMMAKLSNLDKYDIHHLHSAVSAGEPLN
KEVVNQFEAHFGLTVRDGYGQTESTLLIGFLKDTKPRPGSMGKAIPGSDTTVVDDEGRQV
APGVKGNIGVPLDLPALFKGYYKDEARTKAAHAGKYYITGDLAHIDEDGYFWFEGRSDDI
IISSGYTIGPFEVEDALTHHPAVKECAVVASPHEIRGNIVKAFVILNEGYKASDDLVKTL
QDFTKKTVAPYKYPRAIEFVEDLPKTNSGKIRRVELRDAERQKYNQQFKQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatcaagtttattagcgccagaaacatataatattgtcagtgaaattgaaaaa
catgtttctgaccaagataaaaatgcaattatttatgaaaatggacataatgacccaatc
gcggtaacttatgcagacttaatgaaacaagctaatcaagtcgggcatgtgctgttaaat
catggtctcaaaaagggagataaaattttaatcatgatgccgcggtcaatctctacatat
agaatttatatcgctgcattaaagctcggtattgcaattattccaagttctgaaatgctg
cgtactaaagatttgcaatatcgtatttcgcacggagaaatagatgcggttattactatg
ccggaatttattaaagagtttttgaatatagaggagtatacatcattaactaaatttgtt
gtcgcaggacaccatgaagcatggatttctattgatgacgagcgcttgaatcaaagtgaa
gaattagatatggcaccaaccagtcgagatgatattgcgatactatcttatacgtccggt
acaacagggaatccaaaagcagttacacatacacatggttggggttttgctcatatgaaa
atggcacctaagcattggttaagtattaaagaagatgatctggtgtgggcaaccgctgca
ccaggttggcaaaaatgggtatggacacctttcctttctattatggggtcaggagctaca
gcatttgtttacaatggcaagtttaatcctactcggtacttagagctattacaaaatttt
aagattaatgtcttatgctgtacgccaacagagtatcgaatgatggctaaattatccaat
ttagataagtatgatattcatcatttacatagtgcagtatcagctggtgagcctttaaat
aaagaggttgttaatcagtttgaagcgcactttgggcttactgttcgtgatggctatggt
caaacagagagcacattattgattggatttttaaaagatacaaaaccacgcccaggttct
atgggtaaagcaattccaggtagtgacacaacagtagttgatgatgaaggacgccaagtt
gctcctggtgtgaaaggaaatattggtgtaccactagatttaccagcattatttaaaggt
tattataaagatgaagcgcgaactaaagccgcacatgctgggaagtattatatcactggt
gatttagcacatattgatgaagatggttatttctggtttgaaggacgcagtgatgatatc
atcatcagttctggttacacgattggaccttttgaagtagaagatgcattaactcatcat
ccagccgtaaaagaatgtgcagtggtagccagtccccatgaaatacgtggaaatatagtc
aaagcatttgttattttaaatgagggttataaagcaagtgatgacttagttaaaacattg
caagactttactaaaaagaccgttgcaccatataaatatcctagagcgattgaatttgta
gaagatttaccaaagaccaattccggaaaaattcgtcgtgtagaattgcgtgatgcagaa
cgtcaaaagtacaaccaacaatttaaacaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system