KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_00382Help
Entry
SLGD_00382        CDS       T01177                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLGD_00382
Enzymes [BR:slg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SLGD_00382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
420757..422196
Genome map
AA seq 479 aa AA seqDB search
MAKLPQDFLWGGALAANQFEGGYDQGGKGLSVIDVMTAGAHGQAREITQDIEPDKYYPNH
MGIDFYHRYKEDVALFAEMGLKCLRTSIAWTRIFPNGNETEPNEAGLQFYDDLFDELLKY
DIQPVITLSHFEMPLHLAREYGGFRNRKVADYFAYFAETVFKRYKDKVKYWMTFNEINNQ
MDINNPIFLWTNSGVSLTDDDNKLEVLYQVAHNELIASAKAVKIGKEINPDFEIGAMISH
VPIYPYSCNPQDIMEAEIASRMRFFFPDVQARGYYPGYATKMFEREGFDIGWQEGDDVIL
REGKVDYIGFSYYMSTAVKSDNEASVEDNIVNGGLPNSVDNPYIKKSDWGWAIDPVGLRY
TLNALYNRYQIPLFIVENGFGAVDEFDDKGKIHDEYRIEYLREHIEAAIDAVDQDGVELM
GYTPWGIIDIVSFTTGEMKKRYGLIHVDRDNDGNGSLERTKKDSFDWYRKVIESNGEVL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattaccacaagatttcttatggggcggcgcacttgctgccaatcaatttgaa
ggtggctatgaccaaggtggcaaaggcttaagtgtaattgacgtaatgacagcaggcgca
catggtcaagcacgtgaaattacacaagatatagaacctgataaatattatcctaatcat
atgggtattgatttttaccatcgctataaagaagatgtcgcattgtttgctgaaatggga
ttgaaatgtttgcgtacatcgattgcatggacacgtattttccctaatggtaatgaaaca
gaaccgaacgaagcaggactgcaattctatgatgatttatttgatgaattattgaaatat
gacattcaaccagtgattacattatcgcattttgagatgccactacatctagcacgtgaa
tatggcggttttagaaaccgtaaagtagcagattattttgcatattttgctgaaactgta
tttaagcgttataaagacaaagttaaatactggatgacatttaatgaaattaataaccaa
atggacatcaataatcctattttcttatggacaaactctggtgtatcgttgacagatgat
gataataaattagaagtattatatcaggtggcacataatgaattgattgcgagtgcgaaa
gcagtaaaaattggtaaggagataaatccagattttgaaattggtgctatgatttcccat
gtaccaatctacccatatagctgtaatccgcaagatataatggaggcagaaatcgcgagt
cgtatgcgtttcttctttccagatgtacaagcacgaggttattacccaggttatgcgaca
aaaatgtttgaacgtgaaggcttcgacattggttggcaagaaggagacgatgtgattcta
cgtgaaggtaaagtcgattatattggatttagttattatatgtctacggccgttaaatct
gataatgaggctagtgtagaagataatatagtaaatggcggattaccaaattcggttgat
aatccttatattaagaaaagtgattggggctgggccattgatccggttggcttacgttac
acattaaatgcattatataatcgttatcaaattcctttatttatagttgaaaatggattt
ggtgccgtagatgagtttgatgataaaggtaaaatccatgacgaatatcgtatcgagtat
ttacgtgaacatattgaagcggctattgatgcagtagatcaagatggcgtagaattaatg
ggctatacaccttggggtattattgatattgtatcctttacgacaggtgaaatgaaaaaa
cgttatggtttaattcatgttgatcgtgataatgacggtaacggttcattagaacgtacc
aagaaagattcatttgactggtatcgcaaagttattgagtcaaatggggaagttttgtaa

DBGET integrated database retrieval system