KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_00455Help
Entry
SLGD_00455        CDS       T01177                                 

Definition
alcohol dehydrogenase
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SLGD_00455
Enzymes [BR:slg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SLGD_00455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(500996..502051)
Genome map
AA seq 351 aa AA seqDB search
MKAYNYEKPGVAKLIDKEKPVVTESTDAIIRMVKTTICGTDLHIIKGDTPEVPKNTTLGH
EGIGIVESVGSNVNNFKVGDKVIVSCISSCGKCYYCKKGIYAHCENDGGWILGHLINGTQ
AEYVRVPFADNSLYHAPESLPDEALVMLSDILPTGYEIGVLKGKVKPGSTVAIVGAGPVG
LAALLTAQFFSPSKIIMLDLDDNRLATAKSLGATHTINSTHTEEAIKKVKELNRRGVDVA
IEAVGIPQTFDLCQKLIGVDGTIANVGVHGLPVQFDIDKLWIKNINVTTGLVSANTTEEL
LEALTTKVIEPEKLVTHYSKLSEIENAYDLFRNATDHKAIKLLIENDITQP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttataattatgaaaaacctggtgtagctaaacttattgacaaagaaaagcct
gtagttacagaaagtacagatgcgattattagaatggtcaaaacgacgatttgtggcaca
gatttgcatatcataaaaggcgatacacctgaagttcctaaaaatacaacattaggccac
gaaggtatcggtattgttgaatctgttggttcaaatgttaacaactttaaagtcggcgac
aaagttattgtgtcttgtatatcatcatgtggtaaatgttattactgtaaaaaaggaatc
tatgcccattgtgaaaatgacggtggttggattttaggccatttaattaatggtacacaa
gcagaatatgtcagagtacctttcgcagacaattcactatatcatgcacctgagtcgtta
ccagatgaagcattggtgatgctttcagatattttaccaactggttacgaaattggtgta
ttaaaaggtaaagttaaaccaggcagcaccgttgctattgttggagccggacctgttggt
ttagcagctttactaaccgctcagttcttctctccttcaaaaatcatcatgctcgactta
gatgacaaccgtttagctacagctaaatcacttggtgcgacgcatacaattaattcaacg
catactgaagaagcgattaaaaaagtgaaagaattaaatcgtcgtggtgtagatgttgct
attgaagctgtaggtatccctcaaacatttgatttatgtcaaaaattgattggtgtggat
ggcacaatcgctaacgttggtgtccatggcttgccagttcaatttgatatcgataaatta
tggattaaaaatataaacgttacaactggtttagtatcagctaatacaactgaagagtta
ttagaagcattaacaactaaagtcatcgaaccagaaaagcttgtcactcattatagtaaa
ttaagtgaaatagaaaatgcttatgatttatttagaaatgcaacggatcacaaagcaatt
aaattactgattgaaaatgatatcactcaaccataa

DBGET integrated database retrieval system