KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_00509Help
Entry
SLGD_00509        CDS       T01177                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SLGD_00509
   00052 Galactose metabolism
    SLGD_00509
   00500 Starch and sucrose metabolism
    SLGD_00509
   00520 Amino sugar and nucleotide sugar metabolism
    SLGD_00509
Enzymes [BR:slg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SLGD_00509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
563880..564746
Genome map
AA seq 288 aa AA seqDB search
MKQIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEASRAGIEDIIIVTGKH
KRAIEDHFDNQKELEMVLEEKGKTELLKKVQYSTDLANIFYVRQKEQKGLGHAIYSARQF
IGDEPFAVLLGDDIVESDTPAIKQLMDAYDETGKSVIGVQEVAESDTHRYGIIDPLEKHG
RRYEVKQFVEKPAQGTAPSNLAIMGRYVLTANIFDYLKTQKRGAGNEIQLTDAIERLNKD
DQVYAYDFEGDRYDVGEKLGFVKTTIEYALKDQEMKEELTQFIKDLNL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaataaaaaaagccatcatacctgctgctggattagggacacgtttcttgcca
gcaactaaagcgatgcctaaagagatgttacccattttagataaaccaacgattcaatat
atcgttgaagaagcgtcacgtgcgggaattgaagatattattatcgtgactgggaaacat
aaacgtgccatcgaagaccattttgacaatcaaaaagaattggaaatggtattagaagaa
aaagggaaaacagaattactaaaaaaagtccaatattctacggatttagctaatattttt
tatgtgagacaaaaagaacaaaaaggtttaggacatgcgatttattcagcgcgacaattt
ataggtgatgagccatttgcggtattattaggtgatgacatagtagaatcagatacacca
gcaatcaaacaactaatggatgcgtatgatgagactggtaagtccgttattggtgtgcaa
gaagtagcagaatcagacacacaccgttatggcatcatagatcctttagagaaacatggt
cgtcgttatgaagtaaaacaattcgttgaaaaaccagcacaaggtactgcaccgtcaaat
ttagctattatgggacgatacgtcttaactgccaatatatttgattatctaaaaacacaa
aaaagaggcgctggaaatgaaatacaattgacagatgctatcgaacgcctaaacaaagat
gatcaagtatatgcatacgattttgaaggtgatcgctacgatgttggagaaaaacttggg
tttgttaaaacaacgatagaatatgccctcaaagatcaagaaatgaaagaagaattaaca
cagtttattaaagatttaaatttataa

DBGET integrated database retrieval system