KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_00578Help
Entry
SLGD_00578        CDS       T01177                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLGD_00578
   01230 Biosynthesis of amino acids
    SLGD_00578
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLGD_00578
  Energy metabolism
   00680 Methane metabolism
    SLGD_00578
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SLGD_00578
Enzymes [BR:slg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SLGD_00578
Exosome [BR:slg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SLGD_00578
  Exosomal proteins of melanoma cells
   SLGD_00578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
639663..640349
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWTDVDLSEQGINEAVTAGCKVKENNIEIDVAYTSLLKR
ALETTNYILKESDQLWIPVHKSWRLNERHYGKLQGLNKDDARKEFGEEQVHKWRRSYDIE
PPAETEAQREEYLQSRKYRHLDKRMMPYSESLKTTLDRVVPIWTDHISQHLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIIGYEIKTGAPLVYELDDNLNVTNKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaattaattttatgtagacatggacaaagtgaatggaacgcaaaaaacttattt
acaggatggactgatgtcgatttatctgaacaaggtattaacgaagcagtcacagctgga
tgtaaggttaaagagaacaacatcgaaattgatgtagcctatacatcactgttaaaaaga
gcgctagaaactacaaattatatccttaaagaatcagatcagttatggattccagtgcat
aaaagctggcgtttaaatgaaagacattatggtaagcttcaaggattaaataaagatgat
gcgcgaaaagaatttggtgaagaacaagttcataaatggcgtcgttcatatgatattgaa
ccaccagctgaaacagaagcacaacgtgaagaatatctacaaagcagaaaatatcgtcac
ttagataaacgtatgatgccatactctgaaagtttaaaaacaacattagatcgtgttgta
ccaatttggacagaccatatttcacaacatttattagatggtcaaacagtattagtttct
gcacatggtaactctattcgcgccttaatcaaatacttagaagatgtttcagatgaagac
attatcggttacgaaattaaaacaggtgcgccacttgtttatgaattagatgataactta
aacgttacaaataaatattatctttaa

DBGET integrated database retrieval system