KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_00865Help
Entry
SLGD_00865        CDS       T01177                                 

Definition
glucosamine-fructose-6-phosphate aminotransferase (isomerizing) (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SLGD_00865
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SLGD_00865
Enzymes [BR:slg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     SLGD_00865
Peptidases [BR:slg01002]
 Cysteine Peptidases
  Family C44
   SLGD_00865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
925831..927636
Genome map
AA seq 601 aa AA seqDB search
MCGIVGYIGYDKAKELLLSGLEKLEYRGYDSAGIAVANEEGTKVFKEKGRIAELRKVADN
NDIDGSIGIGHTRWATHGVPNYQNSHPHQSTSGRFTLVHNGVIENYEELRDSYLTDVTLV
SDTDTEVIVQLVEYFSNKGLSTEEAFTKVVSLLHGSYALGLIDEQDKDTIFVAKNKSPLL
VGLGDHFNVIASDALAMIKVTNQYKEIKDHEIVIVKRESVTIKDLDGNIQERDAYTAEID
ASDAEKGVYAHYMLKEINDQPAVMRRIIQEYQDGQGNLKIDADIVKDVAEADRIYIIAAG
TSYHAGLVGKEYLEKWAGTPTEVHVASEFVYNTPLLSKKPLFIYISQSGETADSRAVLVE
SNRLGHKALTITNVAGSTLSREADHTLLLHAGPEIAVASTKAYTAQIAVLAILSQVIAKH
HGHEADIDLLRELAKVTTAIETIVDDTPKMEQIATDFLATTRNAFFIGRTMDYNVSLEGA
LKLKEISYIQAEGFAGGELKHGTIALIEEGTPVIGLATQEKVNLSIRGNVKEVVARGAHP
CIISMEGLEKEGDTYVIPRVHELLTPLVSVVTLQLISYYAALHRGLDVDKPRNLAKSVTV
E
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgtaggttatataggttatgataaggccaaagaattattattatcaggg
ttagaaaaattagaatatagaggttatgattcagcaggtattgctgttgctaatgaagag
ggaacaaaggtttttaaggaaaaaggtagaatcgctgaattacgcaaagtggctgacaat
aatgatattgatggatctattggaatcggtcacacgcgttgggctacacacggcgtccct
aattaccaaaactcacatccacatcaatcaacaagtggacgctttacattagttcataac
ggtgtaattgaaaattatgaagaactaagagatagctatttaacagatgtaacattggta
tctgatacagacactgaagttatcgttcaattagtagaatatttttcaaataaagggtta
tctactgaggaagcttttactaaagttgtatctctcttacatggctcttatgctttaggt
ttaatagatgaacaagacaaagatacaatcttcgttgctaagaataaatcacctttatta
gttggtcttggagatcattttaatgttattgcttcggatgctttagcaatgattaaagtt
acgaatcaatataaagaaattaaagatcatgaaattgttatcgttaaaagagaaagtgta
acaattaaagatttagatggcaatattcaagaacgtgatgcatatacagctgaaattgat
gcttcagatgctgaaaaaggtgtttatgcccactatatgctaaaagaaattaatgatcaa
ccagctgtcatgagacgtattatccaggaatatcaagatggacaaggtaatttaaaaata
gatgctgatattgttaaagatgttgctgaagcagaccgtatctatattattgcagcaggt
acaagttatcacgccggtttggtaggtaaagaatatcttgaaaaatgggcaggtacgcct
acagaagtgcatgtagcatcagaatttgtctataatacacctctactatctaaaaaacca
ttatttatctatatttcacaatctggtgaaacggctgatagtcgtgcagtgttagttgaa
tctaatcgactaggacataaggcattgaccattacgaatgttgctggttctacgctatca
cgtgaagcagatcatacactgttgttacatgctggtccagagattgcggttgcttcaaca
aaagcatatacggcacaaattgctgtattggcaatattatctcaagtaattgccaaacat
catggtcatgaagcagatatagatttattaagagagttagctaaagtaacgacagcaatt
gaaacaattgtagatgatacaccaaaaatggagcaaattgcgacagactttttagcaact
acacgtaatgccttctttattggtcgaacaatggattataatgtcagtcttgaaggagca
ctgaaattaaaagaaatttcatatattcaggctgaaggttttgcgggtggagaattaaaa
cacggtacgattgcacttattgaagaaggaacaccagtaatagggctagccactcaagaa
aaggtgaacttatctattcgtggtaatgtcaaagaagttgttgcacgcggtgcacatcca
tgtattatttcaatggaaggcttggaaaaagaaggagacacatatgtaattcctcgtgtt
catgagttgttaacacctttagtatcagtagttacattgcaacttatttcatattatgca
gcgttgcatagaggattagatgttgataaaccacgtaatttagcaaaatcagtgacggtt
gaataa

DBGET integrated database retrieval system