KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_00865Help
Entry
SLGD_00865        CDS       T01177                                 

Definition
glucosamine-fructose-6-phosphate aminotransferase (isomerizing) (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:slg00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:slg00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
925831..927636
Genome map
AA seq 601 aa AA seqDB search
MCGIVGYIGYDKAKELLLSGLEKLEYRGYDSAGIAVANEEGTKVFKEKGRIAELRKVADN
NDIDGSIGIGHTRWATHGVPNYQNSHPHQSTSGRFTLVHNGVIENYEELRDSYLTDVTLV
SDTDTEVIVQLVEYFSNKGLSTEEAFTKVVSLLHGSYALGLIDEQDKDTIFVAKNKSPLL
VGLGDHFNVIASDALAMIKVTNQYKEIKDHEIVIVKRESVTIKDLDGNIQERDAYTAEID
ASDAEKGVYAHYMLKEINDQPAVMRRIIQEYQDGQGNLKIDADIVKDVAEADRIYIIAAG
TSYHAGLVGKEYLEKWAGTPTEVHVASEFVYNTPLLSKKPLFIYISQSGETADSRAVLVE
SNRLGHKALTITNVAGSTLSREADHTLLLHAGPEIAVASTKAYTAQIAVLAILSQVIAKH
HGHEADIDLLRELAKVTTAIETIVDDTPKMEQIATDFLATTRNAFFIGRTMDYNVSLEGA
LKLKEISYIQAEGFAGGELKHGTIALIEEGTPVIGLATQEKVNLSIRGNVKEVVARGAHP
CIISMEGLEKEGDTYVIPRVHELLTPLVSVVTLQLISYYAALHRGLDVDKPRNLAKSVTV
E
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgtaggttatataggttatgataaggccaaagaattattattatcaggg
ttagaaaaattagaatatagaggttatgattcagcaggtattgctgttgctaatgaagag
ggaacaaaggtttttaaggaaaaaggtagaatcgctgaattacgcaaagtggctgacaat
aatgatattgatggatctattggaatcggtcacacgcgttgggctacacacggcgtccct
aattaccaaaactcacatccacatcaatcaacaagtggacgctttacattagttcataac
ggtgtaattgaaaattatgaagaactaagagatagctatttaacagatgtaacattggta
tctgatacagacactgaagttatcgttcaattagtagaatatttttcaaataaagggtta
tctactgaggaagcttttactaaagttgtatctctcttacatggctcttatgctttaggt
ttaatagatgaacaagacaaagatacaatcttcgttgctaagaataaatcacctttatta
gttggtcttggagatcattttaatgttattgcttcggatgctttagcaatgattaaagtt
acgaatcaatataaagaaattaaagatcatgaaattgttatcgttaaaagagaaagtgta
acaattaaagatttagatggcaatattcaagaacgtgatgcatatacagctgaaattgat
gcttcagatgctgaaaaaggtgtttatgcccactatatgctaaaagaaattaatgatcaa
ccagctgtcatgagacgtattatccaggaatatcaagatggacaaggtaatttaaaaata
gatgctgatattgttaaagatgttgctgaagcagaccgtatctatattattgcagcaggt
acaagttatcacgccggtttggtaggtaaagaatatcttgaaaaatgggcaggtacgcct
acagaagtgcatgtagcatcagaatttgtctataatacacctctactatctaaaaaacca
ttatttatctatatttcacaatctggtgaaacggctgatagtcgtgcagtgttagttgaa
tctaatcgactaggacataaggcattgaccattacgaatgttgctggttctacgctatca
cgtgaagcagatcatacactgttgttacatgctggtccagagattgcggttgcttcaaca
aaagcatatacggcacaaattgctgtattggcaatattatctcaagtaattgccaaacat
catggtcatgaagcagatatagatttattaagagagttagctaaagtaacgacagcaatt
gaaacaattgtagatgatacaccaaaaatggagcaaattgcgacagactttttagcaact
acacgtaatgccttctttattggtcgaacaatggattataatgtcagtcttgaaggagca
ctgaaattaaaagaaatttcatatattcaggctgaaggttttgcgggtggagaattaaaa
cacggtacgattgcacttattgaagaaggaacaccagtaatagggctagccactcaagaa
aaggtgaacttatctattcgtggtaatgtcaaagaagttgttgcacgcggtgcacatcca
tgtattatttcaatggaaggcttggaaaaagaaggagacacatatgtaattcctcgtgtt
catgagttgttaacacctttagtatcagtagttacattgcaacttatttcatattatgca
gcgttgcatagaggattagatgttgataaaccacgtaatttagcaaaatcagtgacggtt
gaataa

DBGET integrated database retrieval system