KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01131Help
Entry
SLGD_01131        CDS       T01177                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SLGD_01131
Enzymes [BR:slg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SLGD_01131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1167903..1169300
Genome map
AA seq 465 aa AA seqDB search
MSKKIAIVGAGITGLSSAYYLNKQDADLDITVFEAANRPGGKIQTYRQDGYTIELGPESY
LGRKTIMTDIAHEIGLGQDLITNRTGKSYIFAKNKLYPIPGGAIMGIPTDIKPFIKTKLI
SPLGKLRAGLDLFKKPIIMPNNDISVGQFFRQRLGDEVLEHLIEPLIGGIYGTDIDRLSL
MSTFPEFKEREEQYGSLIKGMKYEKEQRIKKRELYPGSPKGQFKQFRHGLSSFIEALADF
IKQKGVKIEYHTPIKDILVSQKSYQLITEENKVDFDAIIVTTPHQTFMNWFSHDPAFDYF
KHMDATSVATIVMAFDESNIENTYDGTGFVIARTSDTHITACTWTSKKWPFTTPEGKVLI
RAYIGKPGDTVVADHTDDELVSMARKDLTKMMTFKGEPDFTIVNRLEKSMPQYHVGHIKN
IHEIQSHIKRTYPRLRITGAPFEAVGLPDCISQAKKAADEIYHEL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaaaaaaattgcgatagttggagcgggaattactggattatcaagtgcatattat
ttaaataagcaagacgccgatttagatatcactgtttttgaagcagcaaatcgtcctggg
gggaaaattcaaacctatcgtcaagatggttatacgattgagctgggtcctgaatcatat
ttaggacgcaaaacaataatgacagatatcgcacatgaaatcgggcttggacaagactta
attactaacagaacagggaagtcttatatttttgccaagaataagttatacccaattcct
ggtggggcaattatggggattccaacagatataaaaccatttattaagacaaaattaatc
tctccgttgggcaaactacgtgcaggtttagatttatttaaaaaaccaatcatcatgcca
aataacgatatttcagtcggccagttttttagacagcgtttaggagatgaagtacttgaa
catcttattgaaccattaattggcggaatttatggtacagatatagatcgattaagtcta
atgagtacatttcctgaatttaaagagcgggaagaacaatatggcagtttaattaaaggt
atgaaatatgaaaaagagcaacgtatcaagaaaagagaattatatcctggatcgcccaaa
ggacaatttaaacaatttagacatggtttgagttcgtttattgaagcattggctgatttt
attaaacaaaaaggcgtaaaaattgaataccatacacctattaaagatattttagtgtca
caaaaaagttatcaacttattacagaagaaaataaagttgattttgatgcaattattgtg
actacacctcatcagaccttcatgaactggtttagtcatgatccggcatttgattacttt
aagcatatggatgctacatcagtagctacaattgtcatggcctttgatgagtccaatatt
gaaaatacctatgatggaactggatttgtaatagctagaaccagtgacacgcacattacg
gcttgtacatggacctcaaaaaaatggcctttcactacgccagaaggcaaagtgttaata
cgtgcttacattggaaaacctggtgatacagtagtagctgaccataccgatgatgagtta
gtgtcaatggcacggaaagatttgacaaaaatgatgacatttaaaggagaaccagatttt
acaattgttaatcgtttagaaaaaagtatgccacagtaccatgttggacatataaaaaat
attcatgaaattcaatcgcatattaaacgaacatacccgagattgcgtattaccggtgca
ccatttgaagcagtaggacttccagactgcatatcacaagcgaaaaaagctgctgatgaa
atatatcatgaattataa

  All links  
No link information was found.   
DBGET integrated database retrieval system