KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01199Help
Entry
SLGD_01199        CDS       T01177                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:slg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:slg00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:slg00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:slg00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:slg00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1226890..1228599
Genome map
AA seq 569 aa AA seqDB search
MKVEVYKSEPGEYNLSNYEDVYQNFDWNEVEKAFSWYKTGKINMAYECIDRHVDDGKGDK
IALNYKDNERQEQYTFSDIQHLSNQAANVLVEHANVQKGDRVFIFMPRTPELYFAFLGIL
KVGAIVGPLFEAFMEKAVTDRLANSEAKVVITTNKLLHRIPQEKLPHLKKIIIVDDDVSD
DYIDFNKLMQSASTSFNITWLQRDDGLILHYTSGSTGQPKGVLHVQQAMLLHYITGKYVL
DLQENDVYWCTADPGWVTGTSYGIFAPWLNGVTNCIAGGRFTPEQWYKMIEAFKVTIWYT
APTALRMLMSAGDDIVQKYNLSTLRSILSVGEPLNPEVIKWAKSAYGKRVLDTWWMTETG
GHMIVNYPAMDVKLGSMGKPIPGVEAAIIDDEGNELPANRMGNLAIKKGWPSMMYEIWDN
PEKYRSYFIGDWYISGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
EAGVIGKPDPVRGEIIKAFVALRQGYEPTDDLKEDIKKYVKEGLSAHAAPREIEFRDKLP
KTRSGKIMRRVLKAWELNLDAGDLSTMED
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagaagtatataagagtgaaccgggagaatataatttaagcaattatgaggat
gtatatcaaaactttgattggaatgaagtagaaaaagctttttcatggtataaaacaggg
aaaatcaatatggcatatgaatgtatagatcgtcacgtagacgatggtaaaggagacaaa
atcgctttaaactataaagataatgagcgtcaggaacaatatacattttcagatatacag
cacttatccaatcaagcggcgaatgtattagtagagcatgcaaatgtgcaaaaaggggat
cgcgtttttatctttatgccgagaacacctgaattgtattttgcctttttaggtatatta
aaagtaggtgcaattgttggtccattatttgaggcttttatggaaaaggcagtaacagat
cgtttagcgaatagtgaagccaaagttgttataacaacaaataaattacttcatcgtata
ccacaagaaaaattaccacatctcaaaaaaatcattatcgtggatgatgatgtgtctgat
gactatatagattttaataagttaatgcaatcagctagcacatcatttaatatcacatgg
ttacaacgcgacgatggtttaatattacattatacttcaggttcaacaggacagcctaag
ggcgtacttcatgtacaacaagcaatgctacttcattatataacggggaaatatgtatta
gatttacaagaaaacgatgtatattggtgtacagctgatccgggttgggttactggaact
tcttacggtatatttgcaccttggctaaatggcgtcacaaattgtatagcaggtggacgt
tttacgcctgaacagtggtataagatgattgaagcattcaaagttacaatttggtatacg
gcaccaaccgcgttacgcatgttgatgagtgctggtgatgatattgttcaaaaatataat
ctgtcaacgttacgatctattctatctgtaggagaaccattaaacccagaagttatcaaa
tgggcaaaatcagcatatggtaaacgtgttcttgatacgtggtggatgactgaaacagga
ggacatatgattgttaattatcctgcaatggatgtcaaattgggttctatgggaaaacca
attcctggtgtggaagctgctattatcgatgatgagggaaatgaattgccagctaatcgt
atgggcaatttagcaataaaaaaggggtggccgtctatgatgtatgaaatatgggataat
ccagaaaaatatcgttcttattttataggagactggtatatatctggggattcagcatat
aaagatgaagatgggtacttctggtttcaaggtcgtgtagatgatgtcatcatgacagca
ggcgaacgtgtgggaccatttgaagtcgaatctaaattagttgagcatgaagctgttgct
gaagctggtgtcatcggaaagcctgatccagtacgtggcgaaattataaaagcatttgtt
gctttacgccaaggatatgaaccgactgatgatttaaaagaagatattaaaaaatatgta
aaagaaggtctatcagctcatgctgctcctagagaaattgagtttagagataaattgcct
aagacgcgttcaggtaaaattatgcgacgtgtacttaaagcatgggaacttaatttagat
gcaggtgatttaagtactatggaggactaa

DBGET integrated database retrieval system