KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01199Help
Entry
SLGD_01199        CDS       T01177                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
slg00010  Glycolysis / Gluconeogenesis
slg00620  Pyruvate metabolism
slg00640  Propanoate metabolism
slg00680  Methane metabolism
slg01100  Metabolic pathways
slg01110  Biosynthesis of secondary metabolites
slg01120  Microbial metabolism in diverse environments
slg01130  Biosynthesis of antibiotics
slg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLGD_01199
   00620 Pyruvate metabolism
    SLGD_01199
   00640 Propanoate metabolism
    SLGD_01199
  Energy metabolism
   00680 Methane metabolism
    SLGD_01199
Enzymes [BR:slg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SLGD_01199
Lipid biosynthesis proteins [BR:slg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SLGD_01199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADC87290
Position
1226890..1228599
Genome map
AA seq 569 aa AA seqDB search
MKVEVYKSEPGEYNLSNYEDVYQNFDWNEVEKAFSWYKTGKINMAYECIDRHVDDGKGDK
IALNYKDNERQEQYTFSDIQHLSNQAANVLVEHANVQKGDRVFIFMPRTPELYFAFLGIL
KVGAIVGPLFEAFMEKAVTDRLANSEAKVVITTNKLLHRIPQEKLPHLKKIIIVDDDVSD
DYIDFNKLMQSASTSFNITWLQRDDGLILHYTSGSTGQPKGVLHVQQAMLLHYITGKYVL
DLQENDVYWCTADPGWVTGTSYGIFAPWLNGVTNCIAGGRFTPEQWYKMIEAFKVTIWYT
APTALRMLMSAGDDIVQKYNLSTLRSILSVGEPLNPEVIKWAKSAYGKRVLDTWWMTETG
GHMIVNYPAMDVKLGSMGKPIPGVEAAIIDDEGNELPANRMGNLAIKKGWPSMMYEIWDN
PEKYRSYFIGDWYISGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
EAGVIGKPDPVRGEIIKAFVALRQGYEPTDDLKEDIKKYVKEGLSAHAAPREIEFRDKLP
KTRSGKIMRRVLKAWELNLDAGDLSTMED
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagaagtatataagagtgaaccgggagaatataatttaagcaattatgaggat
gtatatcaaaactttgattggaatgaagtagaaaaagctttttcatggtataaaacaggg
aaaatcaatatggcatatgaatgtatagatcgtcacgtagacgatggtaaaggagacaaa
atcgctttaaactataaagataatgagcgtcaggaacaatatacattttcagatatacag
cacttatccaatcaagcggcgaatgtattagtagagcatgcaaatgtgcaaaaaggggat
cgcgtttttatctttatgccgagaacacctgaattgtattttgcctttttaggtatatta
aaagtaggtgcaattgttggtccattatttgaggcttttatggaaaaggcagtaacagat
cgtttagcgaatagtgaagccaaagttgttataacaacaaataaattacttcatcgtata
ccacaagaaaaattaccacatctcaaaaaaatcattatcgtggatgatgatgtgtctgat
gactatatagattttaataagttaatgcaatcagctagcacatcatttaatatcacatgg
ttacaacgcgacgatggtttaatattacattatacttcaggttcaacaggacagcctaag
ggcgtacttcatgtacaacaagcaatgctacttcattatataacggggaaatatgtatta
gatttacaagaaaacgatgtatattggtgtacagctgatccgggttgggttactggaact
tcttacggtatatttgcaccttggctaaatggcgtcacaaattgtatagcaggtggacgt
tttacgcctgaacagtggtataagatgattgaagcattcaaagttacaatttggtatacg
gcaccaaccgcgttacgcatgttgatgagtgctggtgatgatattgttcaaaaatataat
ctgtcaacgttacgatctattctatctgtaggagaaccattaaacccagaagttatcaaa
tgggcaaaatcagcatatggtaaacgtgttcttgatacgtggtggatgactgaaacagga
ggacatatgattgttaattatcctgcaatggatgtcaaattgggttctatgggaaaacca
attcctggtgtggaagctgctattatcgatgatgagggaaatgaattgccagctaatcgt
atgggcaatttagcaataaaaaaggggtggccgtctatgatgtatgaaatatgggataat
ccagaaaaatatcgttcttattttataggagactggtatatatctggggattcagcatat
aaagatgaagatgggtacttctggtttcaaggtcgtgtagatgatgtcatcatgacagca
ggcgaacgtgtgggaccatttgaagtcgaatctaaattagttgagcatgaagctgttgct
gaagctggtgtcatcggaaagcctgatccagtacgtggcgaaattataaaagcatttgtt
gctttacgccaaggatatgaaccgactgatgatttaaaagaagatattaaaaaatatgta
aaagaaggtctatcagctcatgctgctcctagagaaattgagtttagagataaattgcct
aagacgcgttcaggtaaaattatgcgacgtgtacttaaagcatgggaacttaatttagat
gcaggtgatttaagtactatggaggactaa

DBGET integrated database retrieval system