KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01199Help
Entry
SLGD_01199        CDS       T01177                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLGD_01199
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLGD_01199
   00620 Pyruvate metabolism
    SLGD_01199
   00640 Propanoate metabolism
    SLGD_01199
  Energy metabolism
   00680 Methane metabolism
    SLGD_01199
Enzymes [BR:slg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SLGD_01199
Lipid biosynthesis proteins [BR:slg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SLGD_01199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1226890..1228599
Genome map
AA seq 569 aa AA seqDB search
MKVEVYKSEPGEYNLSNYEDVYQNFDWNEVEKAFSWYKTGKINMAYECIDRHVDDGKGDK
IALNYKDNERQEQYTFSDIQHLSNQAANVLVEHANVQKGDRVFIFMPRTPELYFAFLGIL
KVGAIVGPLFEAFMEKAVTDRLANSEAKVVITTNKLLHRIPQEKLPHLKKIIIVDDDVSD
DYIDFNKLMQSASTSFNITWLQRDDGLILHYTSGSTGQPKGVLHVQQAMLLHYITGKYVL
DLQENDVYWCTADPGWVTGTSYGIFAPWLNGVTNCIAGGRFTPEQWYKMIEAFKVTIWYT
APTALRMLMSAGDDIVQKYNLSTLRSILSVGEPLNPEVIKWAKSAYGKRVLDTWWMTETG
GHMIVNYPAMDVKLGSMGKPIPGVEAAIIDDEGNELPANRMGNLAIKKGWPSMMYEIWDN
PEKYRSYFIGDWYISGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
EAGVIGKPDPVRGEIIKAFVALRQGYEPTDDLKEDIKKYVKEGLSAHAAPREIEFRDKLP
KTRSGKIMRRVLKAWELNLDAGDLSTMED
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagaagtatataagagtgaaccgggagaatataatttaagcaattatgaggat
gtatatcaaaactttgattggaatgaagtagaaaaagctttttcatggtataaaacaggg
aaaatcaatatggcatatgaatgtatagatcgtcacgtagacgatggtaaaggagacaaa
atcgctttaaactataaagataatgagcgtcaggaacaatatacattttcagatatacag
cacttatccaatcaagcggcgaatgtattagtagagcatgcaaatgtgcaaaaaggggat
cgcgtttttatctttatgccgagaacacctgaattgtattttgcctttttaggtatatta
aaagtaggtgcaattgttggtccattatttgaggcttttatggaaaaggcagtaacagat
cgtttagcgaatagtgaagccaaagttgttataacaacaaataaattacttcatcgtata
ccacaagaaaaattaccacatctcaaaaaaatcattatcgtggatgatgatgtgtctgat
gactatatagattttaataagttaatgcaatcagctagcacatcatttaatatcacatgg
ttacaacgcgacgatggtttaatattacattatacttcaggttcaacaggacagcctaag
ggcgtacttcatgtacaacaagcaatgctacttcattatataacggggaaatatgtatta
gatttacaagaaaacgatgtatattggtgtacagctgatccgggttgggttactggaact
tcttacggtatatttgcaccttggctaaatggcgtcacaaattgtatagcaggtggacgt
tttacgcctgaacagtggtataagatgattgaagcattcaaagttacaatttggtatacg
gcaccaaccgcgttacgcatgttgatgagtgctggtgatgatattgttcaaaaatataat
ctgtcaacgttacgatctattctatctgtaggagaaccattaaacccagaagttatcaaa
tgggcaaaatcagcatatggtaaacgtgttcttgatacgtggtggatgactgaaacagga
ggacatatgattgttaattatcctgcaatggatgtcaaattgggttctatgggaaaacca
attcctggtgtggaagctgctattatcgatgatgagggaaatgaattgccagctaatcgt
atgggcaatttagcaataaaaaaggggtggccgtctatgatgtatgaaatatgggataat
ccagaaaaatatcgttcttattttataggagactggtatatatctggggattcagcatat
aaagatgaagatgggtacttctggtttcaaggtcgtgtagatgatgtcatcatgacagca
ggcgaacgtgtgggaccatttgaagtcgaatctaaattagttgagcatgaagctgttgct
gaagctggtgtcatcggaaagcctgatccagtacgtggcgaaattataaaagcatttgtt
gctttacgccaaggatatgaaccgactgatgatttaaaagaagatattaaaaaatatgta
aaagaaggtctatcagctcatgctgctcctagagaaattgagtttagagataaattgcct
aagacgcgttcaggtaaaattatgcgacgtgtacttaaagcatgggaacttaatttagat
gcaggtgatttaagtactatggaggactaa

DBGET integrated database retrieval system