KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01231Help
Entry
SLGD_01231        CDS       T01177                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLGD_01231
   01230 Biosynthesis of amino acids
    SLGD_01231
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLGD_01231
   00030 Pentose phosphate pathway
    SLGD_01231
   00051 Fructose and mannose metabolism
    SLGD_01231
   00052 Galactose metabolism
    SLGD_01231
  Energy metabolism
   00680 Methane metabolism
    SLGD_01231
Enzymes [BR:slg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SLGD_01231
Protein phosphatases and associated proteins [BR:slg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SLGD_01231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1267052..1268020
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNNIEVYGIYQGYQGLLDDNIHKLELGSVGDT
IQRGGTFLYSARCPQFKEAEHRKVGIDNLRKRGIEGLVVVGGDGSYRGAQRISEECPEIQ
TIGVPGTIDNDINGTDFTIGFDTALNTIIECVDKIRDTASSHARTFIVEVMGRDCGDLAL
WAGLSVGAETIMVPEVKTEIKDVAEKIESGIKRGKKHSIVMVAEGCMSGQECADELMKYI
NVDTRVSVLGHIQRGGSPSGTDRVLASRLGGHAVDLLIQGKSGLGVGITHNQLTATPFDE
IFKISDHKFNNDIYELAKKLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgcagtattaactagcggtggtgactcaccaggtatgaacgctgcagta
agagcagttgttcgtacagcgatttacaacaacatcgaggtttatggcatttatcaaggt
taccaaggtttactagatgataatatccataaattagaacttggctctgtaggggatacc
atacaacgtggaggtacatttttatactcagcgagatgtcctcaatttaaagaagcagag
catcgtaaagttgggatagataatcttcgaaagagagggattgaaggtctggttgtcgtt
ggtggcgatggtagttatcgaggcgcacaacgtattagcgaagaatgtcctgaaattcaa
actataggtgttccaggtacgattgataacgatattaatggtactgattttacaatcggt
tttgacacagcattaaatacaatcattgaatgtgtcgataaaataagggatacagcttct
agccatgctcgaacatttattgtagaagtaatgggacgtgattgtggagatctagctttg
tgggctggtctatcagtaggtgccgaaacgattatggtgccagaagttaaaacagaaatt
aaagacgttgccgaaaaaatagagagtggtattaaacgtggtaagaaacattcaattgta
atggttgctgaaggttgtatgagtggccaagaatgtgcggatgaattaatgaaatatata
aacgttgacacacgtgtttcagtattaggtcacattcaacgtggtggaagcccttcaggc
actgaccgtgtactcgcatcaaggttaggcggtcatgcagttgatttgttaattcaaggt
aaatctggtcttggcgtaggtattacgcataaccaacttacagctacgccattcgatgag
attttcaaaatttcagatcataaatttaacaatgatatttatgaactagctaaaaagcta
tctatttaa

DBGET integrated database retrieval system