KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01260Help
Entry
SLGD_01260        CDS       T01177                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:slg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1301577..1302257
Genome map
AA seq 226 aa AA seqDB search
MKPVVVMTQTSNVKSDLIEIVHKPFIKIQSLEFNTQLLHDNYDWIIFSSKNAVQLFYPFF
NSVNIKYVAAIGDKTAQLCQELGIKVDFIPDDYSQEGLISKLKLQNQKLLIPSSAQARPY
LQRKLSQNNKVVKIDLYTPIAHRDNIHEVIKLISNNKIDALTFSSSSAVHYFFEEANLPN
FYAYYAIGRQTANTIRYYGYEPKIADNQTLESLINKIIESRNYNEI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagttgtagtaatgacgcaaacgagtaatgtaaaaagtgatttgattgagatt
gtgcataaaccgtttattaaaatccaatcgcttgaatttaacactcagctattgcacgat
aactatgactggattattttttcttctaaaaatgctgtacaattattttatccttttttt
aatagcgttaatataaagtatgtagcagcgataggggataaaacagcacaactatgccaa
gaactaggtataaaagttgattttatacctgatgattattcccaagaaggacttatttct
aagttgaagttgcaaaatcaaaagcttctaatacctagtagcgcacaagcgcgaccttat
ttgcaacggaaactatcacaaaataataaggtagtaaagattgacttgtatacacctatt
gcacatagggataatatccatgaagtaattaagttgatatcaaataacaaaatcgatgca
cttacattttcaagttcttcagctgtgcattacttttttgaagaagctaaccttccaaac
ttttatgcttactacgcaattggccgtcagactgctaacacgattagatattatgggtac
gaacctaagattgctgataatcaaaccttagaatcattgataaataaaattatagaaagt
aggaattacaatgaaatttga

DBGET integrated database retrieval system