KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01261Help
Entry
SLGD_01261        CDS       T01177                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SLGD_01261
Enzymes [BR:slg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SLGD_01261
Exosome [BR:slg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SLGD_01261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1302247..1303221
Genome map
AA seq 324 aa AA seqDB search
MKFDRHRRLRISETMRNLVRENHVRKEDLIYPIFVVEKDNVKSEITSLPGVYQISLNLLD
DEINEAYDLGIRAIMFFGVPNAKDEVGSGAYDLNGVVQQATRKAKSLHEDLLIVADTCLC
EYTDHGHCGVIDEHTHDVDNDKSLPLLVKTAVSQVEAGADIIAPSNMMDGFVAEIRQGLD
DAGYYNVPIMSYGIKYASSFFGPFRDAADSAPSFGDRKTYQMDPANRLEALRELESDLKE
GADMMIVKPALSYLDIVRDVKNNTNIPVVAYNVSGEYAMTKAAAINGWIDEERVVMEQMV
SMKRAGVDMIITYFAKDICRYLDK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgatagacacagaagattgcgtatttcagaaacgatgcgcaatttagtaaga
gaaaatcacgtaagaaaagaagacttaatttatcctatattcgtagttgaaaaggacaat
gtaaaaagtgagattacttctctacctggagtatatcaaataagcttaaatttattagat
gatgaaattaatgaagcatatgatttaggaattagagcaattatgttctttggtgttccg
aatgctaaagatgaagttggttcaggtgcttatgatcttaatggtgttgttcaacaggca
actcgtaaagcgaaatcattgcacgaagatttattaattgttgcagatacttgtttgtgt
gaatacactgaccatggtcattgtggtgtcattgatgaacatacacatgatgttgataat
gacaaatcattgccattacttgttaaaacagctgtttctcaagttgaagctggtgcagat
attattgcacctagcaatatgatggatgggtttgtggctgaaatacgccaaggtttggat
gacgcaggctactataatgtaccaattatgagttatggtattaaatatgcttctagtttc
tttggaccatttagagacgctgctgattctgcaccatcatttggtgatagaaagacttac
caaatggacccagcaaatcgtttagaagcattaagagaattagaaagtgatttaaaagaa
ggcgcagatatgatgattgttaaacccgctttaagttatttggatattgtgcgggacgtt
aaaaataatacgaatatccctgtagtggcatacaacgtcagtggtgagtatgcaatgaca
aaagctgcagcaataaatggttggattgatgaagaacgtgttgtaatggaacaaatggta
tcaatgaaacgtgccggtgtagatatgattattacttattttgcaaaagatatatgtcgt
tatttagataaatag

DBGET integrated database retrieval system