KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01279Help
Entry
SLGD_01279        CDS       T01177                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:slg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1318088..1318696
Genome map
AA seq 202 aa AA seqDB search
MYAYIKGQLTQLFPTHVVVETQGIGYEIQTPNSYRFQQFYNQAVTIYTSLIVREDAQLLY
GFINEEEKEMFLNLIKVTGIGPKSALAILATSTPNEVKRAIEDENDAYLTKFPGIGKKTA
RQIILDLKGKVNYTEASSNDSIHIDDISSTSQKDNYIAEALLALEALGYSKREISKVEKT
LQQQVVTSVDEAVKIGLQSLIS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcatatattaaagggcaattaactcagctattcccaacccatgtagtggttgaa
acacaaggtatcggttatgaaatacaaacaccaaattcatatcggttccaacaattttat
aatcaagcagtaacgatttacacatcactgattgttagagaggatgctcagttactttat
ggttttattaatgaagaagaaaaggaaatgtttctaaatctgattaaagttacaggaatt
ggacctaaatcagcattagctatcttggctacgagcacacctaatgaggttaaacgtgca
attgaggatgaaaatgacgcatatctaactaaatttcctggtattggaaagaaaactgcg
cgtcaaatcatacttgatttaaaaggaaaagttaattatacagaagcatcatctaatgat
tcaatccatatagatgatatatctagtacctctcagaaagataattatattgcggaagcc
ttattagcgttagaagctttaggttattcaaagcgtgaaatttcaaaagtcgaaaaaacg
ctacaacagcaagtagtaacgtcagttgatgaagcggttaagataggtttacaatcctta
atttcctaa

DBGET integrated database retrieval system