KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01300Help
Entry
SLGD_01300        CDS       T01177                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:slg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SLGD_01300
Enzymes [BR:slg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SLGD_01300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1342663..1345050
Genome map
AA seq 795 aa AA seqDB search
MDNPTLFEPTMLKGTVEVILFQNQDNFYTVLKVDTIESNESFDTMPTVVGFFPNIVEGDV
YTFKGQVVAHPKYGKQLKADTFEKELPQTKDAIITYLSSDLFKGIGKKTAQNIVNTLGEN
AINDILAHPDILTKVSNLSKKKQEQIAQQIAANQESEKIMIHLHDLGFGPKLSMAIYQFY
QSETINVVDNNPYKLVYDIKGIGFNKADTLARNIGIDFNDPERLKAGILFTLEEECIKQG
HTYLPAETILKSAQTMLSTQGDEIIEIHQLEEMLQILMEEDKLILDQQKIAIPSLYYSEL
KSVQNLYRILTHTHKLNELEQSDLQLHIGEIEDSNEVHYAASQKEALQTAINSKIMLLTG
GPGTGKTTVIKGIVELYAEIHGLSLDYADYTDDDFPVVLAAPTGRASKRLQEATGLEAMT
IHRLIGWNQDTQPEDILDNEIKAKLIIIDEMSMVDTWLFHQFLNAVPLDAQIVFVGDEDQ
LPSVGPGQVFKDLIQSKKIPRVNLTEVYRQQDGSSIIELAHHMKQNESIDITKRYHDRSF
INCSAEQIPDVVKKVVSSAVSKGYDMSDIQVLAPMYKGSAGIKRLNQILQTILNPKEPDA
REIEFGDAAFRKGDKVLQLVNRPNDNIFNGDIGIIVGIFWAKENALNKDVIIVDFDGNEI
TFTRQDLIELTHAYCTSIHKSQGSEFPIVIMPVVKQYFRMLQKPILYTGLTRAKQSLVLL
GDPQAFDIGLKTNGQVRMTQLYDLLEAYFGHETQNSTDDNIIAKHKKDTLSAATIYQIDP
MINMNQMTPYDFIER
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggataaccctacactatttgaaccaacgatgttaaagggcaccgtcgaagttattttg
ttccaaaatcaagataatttctatactgtacttaaagttgataccattgaatctaatgaa
tcgttcgatacgatgccaacggttgtagggtttttcccaaatattgttgaaggcgacgta
tacacctttaaaggacaggttgttgcgcatccaaaatatggcaaacaactaaaagctgat
acatttgaaaaagaattaccacaaacgaaagatgctattattacctacttatcaagtgat
ttatttaaaggtattggtaaaaagacagcacaaaatattgttaatactttgggagaaaat
gcaataaatgatattttagctcatccagacatattaacaaaagtttcaaatctttctaaa
aagaaacaagagcaaattgcacaacaaatagcagccaatcaagaatcagaaaaaatcatg
atacacttacatgatttaggatttggccctaaactatcaatggcaatctatcagttttat
caaagtgaaacaataaacgtcgttgataataacccgtataaacttgtatatgatattaaa
ggaattggatttaataaagctgatacattagcacgtaatatcggcatcgactttaatgac
ccagaacgattaaaagctggcatattattcacactagaggaagaatgtattaaacaaggg
catacttatttacctgctgaaacaattcttaaatcagcacaaacaatgttaagtacgcaa
ggggatgaaataattgaaatacatcaacttgaagaaatgttgcaaattttaatggaagaa
gataagttgattcttgatcaacaaaaaattgccatccccagtctttactactcagaatta
aaaagcgtacaaaacttatatcgtatattaactcatacccataaattaaatgaacttgag
caatctgatttacagttgcatattggagagatagaagatagcaatgaagtacattatgct
gcatcacaaaaagaggctttacaaacagctataaactcaaaaatcatgttattaactggc
ggacctggaactggtaagacaactgtcattaaaggtattgtagagttatacgctgaaatt
catggactttctttagattatgcggattacactgatgatgatttcccagtagtattagca
gctcctacaggcagagcatcgaaacgtttacaagaagctactggcttagaggcaatgacc
atccaccgacttataggatggaatcaagatacacaaccagaagacattttagataatgaa
attaaagcaaaattaattatcatagatgaaatgtctatggttgacacttggttatttcat
cagtttttaaatgcggtacctttagatgcccaaattgtatttgttggagatgaagaccaa
ctgccttctgttgggcctggacaagtatttaaggacttaatccagtctaaaaaaatacca
cgtgtcaatttaactgaagtctaccgacaacaagatggttcaagtattattgaattagct
caccacatgaaacaaaacgaatccatagatattacaaaacgttatcatgatagaagcttc
attaattgtagtgcagaacaaattcctgacgttgttaagaaagtagtatccagtgcagtt
agtaaaggatatgacatgagtgatattcaagtacttgctcccatgtataaaggaagtgca
ggtattaaacgtttaaatcaaattctgcaaacaattttaaatcctaaagaaccagacgcc
cgtgaaattgaatttggtgatgctgcattccgcaaaggcgataaagtattacagttagta
aatcgtcctaatgacaatatttttaatggagatattggtattattgttggcattttttgg
gcaaaagaaaatgctttaaataaagatgttattatcgtcgattttgacggtaatgaaatt
acatttacacgacaagacttaattgaattaacgcatgcatattgcacttcgattcacaag
tcccaaggttcagaattcccaatcgttattatgcccgtagtgaaacaatattttagaatg
ttacaaaagcctattctttatactggtttgactagagctaaacaatctttagtattacta
ggggatccacaagcctttgacattggtcttaaaacaaatggtcaagttagaatgacgcaa
ttatatgatttattagaagcatattttggacacgaaacgcagaattctactgatgataat
atcatagctaaacataaaaaagatacattatcagcagcgacaatttatcaaatagatccg
atgattaacatgaatcaaatgacgccatatgactttattgaacgttga

  All links  
No link information was found.   
DBGET integrated database retrieval system