KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01368Help
Entry
SLGD_01368        CDS       T01177                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLGD_01368
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLGD_01368
   00052 Galactose metabolism
    SLGD_01368
   00500 Starch and sucrose metabolism
    SLGD_01368
   00520 Amino sugar and nucleotide sugar metabolism
    SLGD_01368
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SLGD_01368
   00524 Butirosin and neomycin biosynthesis
    SLGD_01368
Enzymes [BR:slg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SLGD_01368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1407740..1408726
Genome map
AA seq 328 aa AA seqDB search
MKNIILAADIGGTTCKLGIFDEQLNQLKKWSIHTDTSDPSGVTLLTQIKQSFEKQLPQQN
YTMDNVIGLGIGVPGPVDFESGVVYGAVNLHWTNHVNVREIFSKMLDCPIYVDNDANVAA
LGEKHKGAGKGADDVVAITLGTGLGGGVISNGKLVHGHNGSGAELGHIRTDFDQRFDCNC
GHAGCIETVASATGVVNLVNFYYPKLTFKSSILPLIKENKVTAKAVFDAAKAGDQFCIFI
TEKVANHIGYLCSIISVTSNPKYIVLGGGMSTAGAILIENIKTDFHHYAFKPAQHNTEIV
QAKLGNDAGITGAAGLIKTYIIEKDGVK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacataattttagcagcagatattggtggcacaacttgtaaactaggcatcttt
gatgaacaattgaatcaattaaaaaaatggtcgattcatacagatacttctgatccatca
ggtgtgacattattaacacaaattaaacaatcatttgaaaaacaactaccacaacaaaat
tacacaatggacaatgtaataggccttgggataggagttcctggtcctgttgattttgaa
agtggtgttgtatatggtgctgttaatctacattggacaaaccatgtaaatgtaagagaa
attttttccaaaatgcttgattgtccaatttatgtagataatgatgctaatgttgcagca
cttggcgaaaaacataaaggtgccggcaaaggtgccgatgatgttgtagctattacactt
ggtactggacttggcggaggcgtaatctctaacggaaaattagttcatggacacaatggt
tcaggtgcggaattaggacacattcgaacagattttgatcaaagatttgattgtaattgt
ggacatgctggttgtattgaaactgttgcttcagctactggtgtggttaatttagttaac
ttttattatccaaaattaacttttaaatcatcaattttacctttaattaaagaaaataaa
gttactgcaaaagcagtttttgatgcagcaaaagctggtgatcaattctgtatttttatc
actgaaaaggttgctaatcatattggctatttatgtagtatcattagtgtaactagtaac
cctaaatatattgtgctaggtggtggtatgtctacagcaggtgcaatattaatagaaaac
atcaaaactgattttcatcattatgcgttcaaaccggctcagcacaatacagagattgtt
caagctaaactaggtaatgatgctggtattacaggcgctgccggtttaattaaaacttat
attattgaaaaggatggtgttaaataa

DBGET integrated database retrieval system