KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01467Help
Entry
SLGD_01467        CDS       T01177                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SLGD_01467
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SLGD_01467
Enzymes [BR:slg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SLGD_01467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1507985..1508770
Genome map
AA seq 261 aa AA seqDB search
MMTILTEIVDYKKRLLANGYYDNKLKSLKDLTPINKPTFKSTLSKSKHLSIIAEIKTKSP
SVPKFNVKDLVKQVQEYEANGAAAISILTDEHYFDGSFERLQNLYSHTTLPILCKDFIID
TIQIDVAKKAGASMILLIVHCLTDSKLKQLYKYAHKLGLEVLVEVHSIKELQRAHQLNAS
LIGINNRDLTTFNTHVEHTNQILRQKHSGRFYISESGIHSREDVLSIVQTGISGILIGGA
LMNCTNISEFLPSLMLEKVNL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgatgactattttaactgaaattgttgattataaaaaaagactattagctaatggttac
tatgacaacaaactaaaatcattaaaagatttaacgccaataaataagcctacatttaaa
tctacacttagcaaaagtaaacatttatctatcattgctgaaattaaaacgaaaagtcct
tcagttccaaaattcaatgtaaaagatttagttaaacaagttcaagaatatgaggctaat
ggcgcagctgcaatttctatattaacggatgaacattatttcgatggaagctttgaacgt
ctacaaaacttatacagccatacaacacttcctatactttgtaaagattttattattgat
acgatacaaatcgatgttgcaaagaaagctggggcctcaatgatattactaatcgttcat
tgtttaacagatagtaaactaaaacaactttacaaatatgcacataaactaggtttggaa
gtactggttgaggtccacagcattaaagaattacaacgtgcgcatcaacttaatgcatca
ttaatcggaattaataatagggatttaacaacttttaacactcatgtagaacataccaat
caaatattacgtcaaaaacattctggcagattctacatttctgaaagtggtatccattcg
agagaagacgtgctatcaatagtacagacaggaatatctggtatactcattggcggtgct
ttaatgaattgcacaaatatctctgaattcttgccaagtcttatgttagaaaaggtaaat
ttatga

DBGET integrated database retrieval system