KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01506Help
Entry
SLGD_01506        CDS       T01177                                 

Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLGD_01506
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLGD_01506
  Amino acid metabolism
   00310 Lysine degradation
    SLGD_01506
Enzymes [BR:slg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SLGD_01506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1546762..1548072)
Genome map
AA seq 436 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEDAGVIQEQLA
NEGDTVEVGQAIAIVGEGSAEAKSAEASKSDGKAESKGESESETTTNTANEDTTRDHEQR
QDEAEKADRSDEVKKHTQRVNATPSARRHALKQGVDLAEVAGKSNDVVRKEDIDQRQQQS
SNKKAETAQRKAPETSSSSTPNKPVIREKMSRRKKTAANKLLEVSNNTAMLTTFNEVDMT
NVMELRKRKKEKFMQDHDGTKLGFMSFFTKAAVAALKKYPEVNAEIDGDDMIKKQYYDIG
IAVSTDDGLLVPFVRDCDKKNFAEIEQEIANLAVKARDKKLGLDDMVNGSFTITNGGIFG
SMMSTPIINGSQAAILGMHSIMTRPIAIDKDTIENRPMMYIALSYDHRIIDGKEAVGFLK
TIKDLIENPEDLLLES
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaaagttccggaattagcagaatcaattacagaggggaccattgcagaa
tggcttaaaaatgttggcgattctgttgaaaaaggagaagcaattttagaattagaaaca
gataaagttaatgtggaagttgtatcagaagatgcaggtgtgattcaagaacaacttgct
aatgaaggtgatactgttgaagtaggacaagccattgccattgttggagaaggtagtgct
gaagcgaaatcagcagaagcttcaaaatctgacggtaaggctgaatctaaaggtgagtcg
gagtcagaaacaactacaaatacagctaacgaagacacaactcgtgatcatgaacagcga
caagatgaagctgaaaaagcagatcgttctgacgaagtaaaaaaacatactcaacgtgta
aatgccacaccttcagcacgtcgtcatgctttaaaacaaggtgtagaccttgctgaagta
gcaggtaaatctaatgatgtcgtaagaaaagaagatattgatcaacgtcaacaacagtca
tcaaataaaaaagcagaaacggcacaaagaaaagcgccagaaacatcatcatcttcgaca
ccaaacaaaccagttattcgtgaaaaaatgtctcgtcgtaagaaaacagcagctaataaa
ttgcttgaagtatcaaataatacagcaatgttaacgacatttaatgaagttgatatgacg
aatgtgatggaattacgtaaacgtaaaaaagaaaaatttatgcaagatcatgatggtaca
aaattaggatttatgtcattcttcacaaaagcagcagtagccgcgttgaaaaaatatcca
gaagtcaatgctgaaattgatggagatgacatgatcaagaaacaatattatgatattggt
atagctgtatcaacagatgatggtttattagttccatttgtaagggactgtgataagaag
aattttgcagaaatcgaacaagaaattgctaatttagcagttaaagcgcgtgataaaaaa
ttaggcttagacgacatggtaaatggatcatttacaattactaacggtggtatcttcggt
tcaatgatgagtacgccaatcatcaatggtagtcaagcagcaatattaggtatgcattca
attatgacacgtccaattgcaattgataaagatacaattgaaaatcgaccaatgatgtat
attgctttaagctatgatcacagaattattgatggtaaagaagcagtaggtttcttgaaa
acaattaaagatctcattgaaaatccagaagatttattattagaatcataa

DBGET integrated database retrieval system