KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01519Help
Entry
SLGD_01519        CDS       T01177                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:slg00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:slg00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1560744..1561229)
Genome map
AA seq 161 aa AA seqDB search
MTLSILVAHDQQRVIGYNNDLPWHLPNDLKHVKKLSTGNTLVMGRGTFESIGKPLPNRRN
VVLTHNQNFQHDGVDVIHSIDEIYNLPGHVFIFGGQSLFDKMIDKVDDMYITVLEGKFKG
DTFFPPYTFEEWEVASSEEGVLDEKNTIPHTFLHLVRRKKN
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacattatcaatattagtagcacatgatcaacaacgcgtgattggctataataacgat
ttaccatggcatttacctaatgatttaaagcatgtgaaaaaattgtcaacaggcaatacg
ttagtcatgggtagaggaacttttgaatccattggtaaacctctacctaatcgacgtaat
gttgtattaacacataatcaaaattttcaacatgatggtgttgatgttatccattctatt
gatgaaatatataatttgccaggtcatgtatttatttttggtgggcaaagtcttttcgac
aaaatgattgataaagtagatgatatgtatattactgtgttagaagggaaatttaaaggt
gatacgttctttccgccatatacttttgaagagtgggaagttgcatcttcagaagaaggt
gttttggatgaaaagaatacaattcctcatacttttttacatttagttagacgtaagaaa
aattag

DBGET integrated database retrieval system