KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01519Help
Entry
SLGD_01519        CDS       T01177                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SLGD_01519
   00670 One carbon pool by folate
    SLGD_01519
Enzymes [BR:slg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SLGD_01519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1560744..1561229)
Genome map
AA seq 161 aa AA seqDB search
MTLSILVAHDQQRVIGYNNDLPWHLPNDLKHVKKLSTGNTLVMGRGTFESIGKPLPNRRN
VVLTHNQNFQHDGVDVIHSIDEIYNLPGHVFIFGGQSLFDKMIDKVDDMYITVLEGKFKG
DTFFPPYTFEEWEVASSEEGVLDEKNTIPHTFLHLVRRKKN
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacattatcaatattagtagcacatgatcaacaacgcgtgattggctataataacgat
ttaccatggcatttacctaatgatttaaagcatgtgaaaaaattgtcaacaggcaatacg
ttagtcatgggtagaggaacttttgaatccattggtaaacctctacctaatcgacgtaat
gttgtattaacacataatcaaaattttcaacatgatggtgttgatgttatccattctatt
gatgaaatatataatttgccaggtcatgtatttatttttggtgggcaaagtcttttcgac
aaaatgattgataaagtagatgatatgtatattactgtgttagaagggaaatttaaaggt
gatacgttctttccgccatatacttttgaagagtgggaagttgcatcttcagaagaaggt
gttttggatgaaaagaatacaattcctcatacttttttacatttagttagacgtaagaaa
aattag

DBGET integrated database retrieval system