KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01586Help
Entry
SLGD_01586        CDS       T01177                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:slg00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:slg00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1635800..1636276
Genome map
AA seq 158 aa AA seqDB search
MENIYDIVVQTSDGKDYKLEKYKGDVMLIVNTASECGFTPQFEGLQEIYDKYKEQGLVVL
GFPCNQFGGQEPGSGAEANQNCKINYGVTFPIHEKIDVKGEHQHPLFRFLTDAQHGMFNE
KIKWNFTKFLVDRQGHVVKRFSPQKKPAQLHEAIEALL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatttatgatattgtcgttcaaacttcagatggtaaagactataaattagaa
aaatataaaggggacgtcatgctcatcgtgaatactgcaagtgagtgtggttttacacct
caatttgaaggacttcaagagatttatgataaatacaaagaacaaggtcttgtcgtatta
ggttttccatgtaatcaattcggtggtcaagaacctggttctggtgctgaagctaatcaa
aattgtaaaattaattatggtgtcacattccctattcacgaaaaaattgatgtaaaggga
gagcatcaacatccattatttagatttttaactgacgcgcaacatggtatgtttaatgag
aaaattaaatggaattttacgaagtttttagttgatcgtcaaggtcatgtggttaaacgt
ttttctcctcaaaagaaacctgcacaattacatgaagcaattgaagctcttttataa

DBGET integrated database retrieval system