KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01592Help
Entry
SLGD_01592        CDS       T01177                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SLGD_01592
Enzymes [BR:slg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SLGD_01592
Exosome [BR:slg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SLGD_01592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1640636..1642135)
Genome map
AA seq 499 aa AA seqDB search
MEKYILSIDQGTTSSRAILFNKDGEIKGISQREFKQYFPQSGWVEHDANEIWTSVLSVMA
EVLNENNVNANQIEGIGITNQRETAVVWDKNTGRPIYHAIVWQSRQTQGICQELKEQGHE
EKFRDRTGLLLDPYFAGTKVKWILDHVEGAREKAANGELLFGTIDSWLVWKLSGKEAHVT
DYTNASRTLMFNIYDLKWDDELLEILDVPRNMLPEVKASSEIYAKTISYHFFGQEVPISG
IAGDQQAALFGQACFDRGDVKNTYGTGGFMLMNTGEKAVKSESGLLTTIAYGLDGKVNYA
LEGSIFVSGSAIQWLRDGLRMINSAPQSENYATRVESTEGVYVVPAFVGLGTPYWDADAR
GAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSNIEVNNLRVDGGAVKNNFLMQF
QADIVDTPVERPEIQETTALGAAYLAGLAVGFWDSKDEIAHRWKLEKEFEPQMEDQERTK
LYKGWKKAVEATQIFKLEQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtatattttatcaattgatcaaggaactacaagttctcgtgccattttattt
aacaaagatggagaaatcaaagggatttcacaacgagaattcaaacaatatttcccacaa
tctgggtgggtagaacacgatgcgaatgaaatttggacgtcggtgttatcagttatggct
gaagtattaaatgagaataatgtcaatgccaatcagattgaggggattggtattacaaat
caacgtgaaacggcagttgtttgggataaaaatacaggacgtcctatttatcatgctatc
gtatggcaatcacgtcaaacacaaggaatttgtcaagaattaaaagaacaaggacatgag
gaaaaattccgtgatcgtactggattattattagatccttatttcgctggtacgaaagta
aaatggattttagaccatgttgaaggggcacgcgaaaaagcagctaatggtgaattgtta
tttggaactatagattcgtggcttgtgtggaaactatctggtaaagaagcacatgttact
gattataccaatgctagccgtaccttaatgttcaatatttatgatttaaaatgggacgac
gaattacttgaaattttggatgttccacgcaatatgttaccggaagtcaaagcttcaagt
gaaatttatgcgaaaacaattagttaccatttctttggtcaagaagtgccgattagtggt
attgccggagatcaacaagctgctttatttggtcaagcatgttttgatcgtggagatgtg
aaaaatacatatggcactggtggctttatgttaatgaatacaggtgaaaaggctgttaaa
tctgaaagtggtttattgacgacgattgcatatggtcttgatggcaaagtgaactatgcg
ttagaaggttctatctttgtatcaggttcggctattcaatggttacgagatggtttaaga
atgattaattctgcaccgcaaagtgaaaattatgcgacacgtgtagaatcaactgaaggg
gtttatgtcgtacctgcatttgtaggattaggaacaccatactgggatgctgatgcacga
ggtgcaatattcggattaacacgtggcacagaaaaagaacactttatacgagctacttta
gaatcattatgctatcaaacacgagatgttatggaagcgatgtctaaagattctaatata
gaagttaacaacttacgtgtcgatggcggcgcagtaaaaaataatttcttaatgcaattc
caagcggatattgtggatacgccagtggaaagaccggaaattcaagaaacaacggcgtta
ggtgcagcatatttagctggattagctgttggtttttgggatagtaaagatgaaattgca
catcgttggaaactagaaaaagaattcgaaccacaaatggaagatcaagaacgaactaag
ctttataaaggatggaaaaaagcagtcgaggcaacacaaattttcaaacttgaacaataa

DBGET integrated database retrieval system