KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01650Help
Entry
SLGD_01650        CDS       T01177                                 

Definition
succinyl-CoA ligase [ADP-forming] subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLGD_01650
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLGD_01650
   00640 Propanoate metabolism
    SLGD_01650
   00660 C5-Branched dibasic acid metabolism
    SLGD_01650
Enzymes [BR:slg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SLGD_01650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1710101..1711267)
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEIFRSMGVAVPEGRVAFTAKEAVEKAKELNSDVYVVKAQIHAGGRGKAGGV
KIAKSLSEVETYANELLGKQLVTHQTGPEGKEVKRLYIEQGCDIQKEYYVGFVIDRATDR
ITLMASEEGGTEIEEVAATTPEKVFKETIDPVVGLSPYQARRIAFNINIPKESINKAAKF
LISLYNVFVEKDCSIVEINPLVTTGDGEVLALDAKINFDDNALFRHKDIQELRDLEEEDP
KEIEASKYDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDVGGGATKEKVTE
AFKIILGDDNVKGIFVNIFGGIMKCDVIAEGIVAAVKEVELTLPLVVRLEGTNVERGKEI
LNDSGLAIEPAATMAEGAQKIVKLVKEA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgagtatcaaggtaaagaaatatttcgttctatgggcgtagctgttcca
gaaggacgtgtcgcatttactgctaaagaagcggtggaaaaagcgaaagaattaaattca
gatgtatatgtggttaaagcacagatccacgctgggggtagaggtaaagcaggtggtgtt
aaaattgctaaatcactttctgaagttgaaacatacgcaaatgaattattaggtaaacaa
ttggtaacgcatcaaactggtccagaaggtaaagaagtgaaacgcttatatatagaacaa
ggttgcgatattcaaaaagagtattatgtcggttttgttattgaccgtgcaaccgatcgt
atcactttaatggcttctgaagagggcggtactgaaattgaagaagtagctgcaacaaca
ccagaaaaagtctttaaagaaacgattgacccagtggtaggtttatcgccttaccaagcg
cgtcgaattgcatttaatattaatattcctaaagaatctatcaacaaagctgcaaaattt
ttaatttctttatataacgtatttgtagaaaaagattgttctattgtggaaattaacccg
ttggtaacaactggagacggtgaagtattagctttagatgctaaaattaactttgatgat
aatgcattattcagacataaagatattcaagaattgcgtgatttagaagaagaagatcca
aaagaaatcgaagcatctaaatatgacttatcatacatcgcattagatggagatatcggt
tgtatggttaacggtgctggtttagcaatggcaacaatggatacaattaatcattttggt
ggaaatccagctaacttcctagacgtaggtggcggtgctacgaaagaaaaagttactgaa
gcttttaaaattatcttaggtgatgacaatgttaaaggtatctttgtaaacattttcgga
ggaattatgaaatgtgacgttattgcagaaggtattgtagcagcagtgaaagaagtagaa
ttaactttaccattagttgtgcgcttagaaggtacgaatgttgaacgcggtaaagagatt
ttaaatgattcaggtttagcaatcgagccagcagctactatggctgaaggtgctcaaaaa
attgttaagcttgttaaagaagcgtaa

DBGET integrated database retrieval system