KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_02052Help
Entry
SLGD_02052        CDS       T01177                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
slg00010  Glycolysis / Gluconeogenesis
slg00051  Fructose and mannose metabolism
slg00562  Inositol phosphate metabolism
slg01100  Metabolic pathways
slg01110  Biosynthesis of secondary metabolites
slg01120  Microbial metabolism in diverse environments
slg01130  Biosynthesis of antibiotics
slg01200  Carbon metabolism
slg01230  Biosynthesis of amino acids
Module
slg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
slg_M00002  Glycolysis, core module involving three-carbon compounds
slg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLGD_02052
   00051 Fructose and mannose metabolism
    SLGD_02052
   00562 Inositol phosphate metabolism
    SLGD_02052
Enzymes [BR:slg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SLGD_02052
Exosome [BR:slg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SLGD_02052
  Exosomal proteins of bladder cancer cells
   SLGD_02052
  Exosomal proteins of melanoma cells
   SLGD_02052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADC88140
Position
complement(2121347..2122108)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTVQEAKDFVNNLPTLPDEKEVESVICAPTIQLDALITLVKEGKATG
LKIGAQNTYFEDNGAYTGETSPVALADLGVKYVVIGHSERRELFHETDEDVNKKAHAVFN
HHMTPIICVGETDEERENGKANDIVSNQVKKAVAGLTDAQLKEVVIAYEPIWAIGTGKSA
TSDDANEMCAQVRRTLAEVSSQDVADATRIQYGGSVKPNNVKEYMAQPDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattattgctggcaactggaaaatgaataaaacagttcaagaagcaaaa
gattttgtaaataatttgccaactttaccagatgaaaaagaagtagagtcagtaatctgt
gcaccaacaattcaacttgatgctttgattacgttagtaaaagaaggtaaagcaacaggc
cttaaaatcggtgctcaaaatacttattttgaggataatggtgcttatacaggtgaaaca
tctcctgtagcattagctgatttaggcgttaaatacgtggttatcggacactctgaacgt
cgtgaattattccatgaaacagatgaagatgtaaataaaaaagcacatgcagtctttaac
catcacatgacaccaattatttgtgtaggtgaaacggatgaagaacgtgaaaatggcaaa
gcaaacgatattgtaagtaatcaagttaaaaaagctgttgctggcttaactgatgcacaa
cttaaagaagttgtaattgcttatgaaccaatttgggcaattggtactggtaaatctgca
acatctgatgatgcgaatgaaatgtgtgcacaagtacgacgcacattagctgaagtttct
agccaagatgtagcagacgcaacacgcattcaatacggtggtagcgttaaaccaaacaac
gtaaaagaatacatggcacaaccagatattgatggcgctttagtcggtggcgcatctctt
aaagtggaagatttcgttcaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system