KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_02052Help
Entry
SLGD_02052        CDS       T01177                                 

Definition
(RefSeq) Triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLGD_02052
   01230 Biosynthesis of amino acids
    SLGD_02052
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLGD_02052
   00051 Fructose and mannose metabolism
    SLGD_02052
   00562 Inositol phosphate metabolism
    SLGD_02052
Enzymes [BR:slg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SLGD_02052
Exosome [BR:slg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SLGD_02052
  Exosomal proteins of bladder cancer cells
   SLGD_02052
  Exosomal proteins of melanoma cells
   SLGD_02052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2121347..2122108)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTVQEAKDFVNNLPTLPDEKEVESVICAPTIQLDALITLVKEGKATG
LKIGAQNTYFEDNGAYTGETSPVALADLGVKYVVIGHSERRELFHETDEDVNKKAHAVFN
HHMTPIICVGETDEERENGKANDIVSNQVKKAVAGLTDAQLKEVVIAYEPIWAIGTGKSA
TSDDANEMCAQVRRTLAEVSSQDVADATRIQYGGSVKPNNVKEYMAQPDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattattgctggcaactggaaaatgaataaaacagttcaagaagcaaaa
gattttgtaaataatttgccaactttaccagatgaaaaagaagtagagtcagtaatctgt
gcaccaacaattcaacttgatgctttgattacgttagtaaaagaaggtaaagcaacaggc
cttaaaatcggtgctcaaaatacttattttgaggataatggtgcttatacaggtgaaaca
tctcctgtagcattagctgatttaggcgttaaatacgtggttatcggacactctgaacgt
cgtgaattattccatgaaacagatgaagatgtaaataaaaaagcacatgcagtctttaac
catcacatgacaccaattatttgtgtaggtgaaacggatgaagaacgtgaaaatggcaaa
gcaaacgatattgtaagtaatcaagttaaaaaagctgttgctggcttaactgatgcacaa
cttaaagaagttgtaattgcttatgaaccaatttgggcaattggtactggtaaatctgca
acatctgatgatgcgaatgaaatgtgtgcacaagtacgacgcacattagctgaagtttct
agccaagatgtagcagacgcaacacgcattcaatacggtggtagcgttaaaccaaacaac
gtaaaagaatacatggcacaaccagatattgatggcgctttagtcggtggcgcatctctt
aaagtggaagatttcgttcaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system