KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_02327Help
Entry
SLGD_02327        CDS       T01177                                 

Definition
Deoxyadenosine kinase/Deoxyguanosine kinase (EC:2.7.1.113 2.7.1.76)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SLGD_02327
   00240 Pyrimidine metabolism
    SLGD_02327
Enzymes [BR:slg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     SLGD_02327
    2.7.1.76  2'-deoxyadenosine kinase
     SLGD_02327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2391541..2392215
Genome map
AA seq 224 aa AA seqDB search
MTKTLIPRDAVITIAGTVGVGKSTLTRALADKLNFKTSFENVDQNPYLDKFYDDFERWSF
HLQIYFLAERFKEQKRMFEYGGGFIQDRSIYEDVDIFAKMHQEQGTMSPEDFQTYSELFN
AMVMTPYFPKPDVLIYLECNYDEVIERIKQRGRDMEINTEPDYWKKLFKRYEDWINNFNA
CPVIRVNINDYDIHENPDSLNPIIEKIAHVIQTHRQVDTRHWTN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacacttattcctcgagacgctgttataacaattgctggtacagtgggtgtt
ggtaaatccacactgacacgggcactagcagataaactcaattttaaaacgtcctttgaa
aatgtcgaccaaaatccgtatcttgataaattttatgatgactttgaacgttggagtttt
cacctacaaatctattttttagctgaacgctttaaagaacaaaaacgcatgtttgaatat
ggcggtgggtttatacaagaccgctctatttatgaagatgttgatatcttcgctaaaatg
catcaagaacaaggaacaatgagtcctgaagatttccaaacttattccgaactatttaat
gccatggtcatgacaccttattttcctaaaccagacgttttaatttatttagagtgtaac
tatgacgaagtcattgaacgcattaaacaacgtggacgtgatatggaaatcaacacagaa
cctgattattggaaaaaattatttaaacgttatgaagattggattaataatttcaatgct
tgtcctgtaatccgagtcaatattaatgactatgatattcatgaaaatccagattcatta
aatcctattattgaaaaaattgcacatgttattcaaacgcatcgtcaagtagatactaga
cattggacgaattaa

DBGET integrated database retrieval system