KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_02327Help
Entry
SLGD_02327        CDS       T01177                                 

Definition
Deoxyadenosine kinase/Deoxyguanosine kinase (EC:2.7.1.113 2.7.1.76)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:slg00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:slg00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2391541..2392215
Genome map
AA seq 224 aa AA seqDB search
MTKTLIPRDAVITIAGTVGVGKSTLTRALADKLNFKTSFENVDQNPYLDKFYDDFERWSF
HLQIYFLAERFKEQKRMFEYGGGFIQDRSIYEDVDIFAKMHQEQGTMSPEDFQTYSELFN
AMVMTPYFPKPDVLIYLECNYDEVIERIKQRGRDMEINTEPDYWKKLFKRYEDWINNFNA
CPVIRVNINDYDIHENPDSLNPIIEKIAHVIQTHRQVDTRHWTN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacacttattcctcgagacgctgttataacaattgctggtacagtgggtgtt
ggtaaatccacactgacacgggcactagcagataaactcaattttaaaacgtcctttgaa
aatgtcgaccaaaatccgtatcttgataaattttatgatgactttgaacgttggagtttt
cacctacaaatctattttttagctgaacgctttaaagaacaaaaacgcatgtttgaatat
ggcggtgggtttatacaagaccgctctatttatgaagatgttgatatcttcgctaaaatg
catcaagaacaaggaacaatgagtcctgaagatttccaaacttattccgaactatttaat
gccatggtcatgacaccttattttcctaaaccagacgttttaatttatttagagtgtaac
tatgacgaagtcattgaacgcattaaacaacgtggacgtgatatggaaatcaacacagaa
cctgattattggaaaaaattatttaaacgttatgaagattggattaataatttcaatgct
tgtcctgtaatccgagtcaatattaatgactatgatattcatgaaaatccagattcatta
aatcctattattgaaaaaattgcacatgttattcaaacgcatcgtcaagtagatactaga
cattggacgaattaa

DBGET integrated database retrieval system