KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_02361Help
Entry
SLGD_02361        CDS       T01177                                 

Definition
glutamyl-tRNA synthetase/glutamyl-tRNA(Gln) synthetase (EC:6.1.1.17 6.1.1.24)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:slg00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SLGD_02361
Enzymes [BR:slg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     SLGD_02361
Amino acid related enzymes [BR:slg01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SLGD_02361
Transfer RNA biogenesis [BR:slg03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SLGD_02361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2429008..2430465)
Genome map
AA seq 485 aa AA seqDB search
MSNRVRVRYAPSPTGYLHIGNARTALFNYLFAKHYDGDFVVRIEDTDSKRNLEDGEASQF
NNLKWLGLDWDESVDKDKGYGPYRQSERADFYNPLIQQLLDEDKAYKCYMTEEELEAERE
AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPAIRFRVPQNHTYTFNDMVKGEISFDSN
NIGDWVIVKKDGVPTYNFAVAVDDHYMEISDVIRGDDHVSNTPKQLMIYDAFGWEPPRFA
HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFITLLGWSPEGEDEIFSKETF
IKIFDEKRLSKSPAMFDRQKLAWVNNQYMKTKDTETVFELALPHLIKANLIPEQPSEEDR
EWGRKLIALYQKEMSYAGEIVPLSEMFFKDMPELGAEEQEVINGAQVPELMQHLYGKLEA
LEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKDKVLSRL
KQYVS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcgcgttagagtaagatacgcaccaagtccaactggatatttgcatattggc
aatgccagaacggcgctatttaattatttatttgcgaaacattatgatggagatttcgtt
gttcgtatagaagatacggacagtaaacgtaatttggaagacggagaagcttcacaattt
aataatttaaaatggttaggcttggattgggatgaatctgtagataaagacaaaggttat
ggcccttatcgtcaatctgaaagagcagatttttataacccacttattcaacaattacta
gatgaagataaagcttataaatgttatatgacagaagaggaattagaagcagaacgtgaa
gcgcaaatcgcgcgtggcgagatgcctcgatacggtggacaacatgcgcatttaacagaa
gaacaacgtcaacaatttgaagcggaaggacgtcaaccagctattcgctttcgtgtacct
caaaatcatacgtatacatttaatgacatggttaaaggtgaaatttcatttgactcaaat
aatataggtgattgggttatcgttaaaaaagacggggtgccaacatacaattttgcagta
gctgtcgatgatcactatatggaaatatcagatgttattcgcggagatgatcatgtttca
aatacgccaaaacaattaatgatttatgatgcgtttggttgggaaccgccgcgtttcgca
cacatgtcattaatcgtcaatgaagagcgcaagaaactaagtaaacgcgatggtcaaatt
ttacaatttatcgagcaatatcgtgacttaggatatttaccagaagcattgtttaacttt
attacattgttaggttggtctcctgaaggtgaagatgaaatcttttctaaggaaacgttt
attaaaatctttgatgaaaagcgtttatctaaatcaccagcaatgtttgatagacaaaaa
ttagcatgggttaacaaccaatatatgaagaccaaagatactgaaacagtatttgaactc
gcgttaccacatttaatcaaagcaaatctaattcctgagcaaccaagtgaggaagatcgc
gaatggggtcgaaaattaattgccttgtatcaaaaagaaatgagctatgcaggagaaatt
gtgccattgtccgaaatgttctttaaagatatgccagaattaggtgcagaagaacaagaa
gtaatcaatggtgcgcaagttcctgaattaatgcaacatttgtatggcaaactcgaagcg
ctagaaccatttgaagctgcagaaatcaaaaaaacaatcaaagaagttcaaaaagaaaca
ggtattaaaggtaaacaattatttatgccaatacgtgttgctgttactggacaaatgcat
ggtcctgaactgccaaatacaattgaagtgttaggtaaagacaaggtgttaagtcgtctg
aaacaatatgtatcatag

DBGET integrated database retrieval system