KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_02392Help
Entry
SLGD_02392        CDS       T01177                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SLGD_02392
Enzymes [BR:slg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SLGD_02392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2456832..2457311)
Genome map
AA seq 159 aa AA seqDB search
MVQAYLGLGSNIGNRHKQLMQAIDILDHFDGIKVTQVSPIYETAPVGYTEQPQFLNLCVE
INTQLTPRELLNCCLETEKQLHRVREVRWGPRTLDVDILLYGDDIIELDQLTIPHPRMTE
RAFVLIPLNDIASTKIEPHSKQTIGNLVKADDSVKKYKQ
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggtacaagcttatctaggtttaggaagtaatattggcaatcgtcataaacagttgatg
caggcaatagacatccttgatcattttgatggtattaaggttacacaagtttctccaata
tacgaaacagctcctgtgggttatacagaacaaccacaattcttaaatttatgtgttgaa
ataaatacgcaacttacaccacgagaattgctcaattgttgtttagaaactgaaaaacag
ttacatcgagtgagagaagtacgttggggtccacgcacattagatgttgatatcttatta
tatggagatgacatcatagagttggatcaattaacgattccccacccaaggatgacagaa
cgtgcattcgtattgatacccctcaatgacattgcgtcgacgaaaatagaacctcattcc
aaacaaacgattggaaacctagttaaggcagacgattcagttaaaaagtataaacaatga

DBGET integrated database retrieval system