KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_02435Help
Entry
SLGD_02435        CDS       T01177                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:slg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SLGD_02435
DNA repair and recombination proteins [BR:slg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SLGD_02435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2506485..2507081)
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLNMKEDDVVQFAKALVDVKRELTYCSVC
GHITENDPCYICEDKQRDRTVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPE
DINIPSLIERLKDEEVKELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
EYADEVTLSKAIAGRTEM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaacctatatctaaactcatagacagttttatgaaattaccaggcatt
ggtcctaagacggctcaacgtctggcttttcatactctaaatatgaaagaagacgacgta
gttcaatttgcgaaggcacttgttgatgtcaaaagagagttaacttattgcagtgtttgt
ggacatatcacagaaaatgacccttgctatatttgtgaagataagcaaagggatcggaca
gtgatttgtgtagtcgaagatgataaagacgttattgctatggaaaaaatgcgggagtat
aaagggctttatcacgtcttacatggttctatatcgccaatggatggtattgggcctgaa
gatataaacatcccttcattaatagaaagattaaaagatgaagaagtgaaagagcttata
ttagcaatgaatccaaatcttgaaggtgaatcgacagcgatgtatatttctagacttgtt
aaaccaataggcattaaagtaacaagacttgcacaaggtttgtcagttggtggagattta
gagtatgcagatgaagtcacactttcaaaagcaatcgctggaagaactgaaatgtag

DBGET integrated database retrieval system