KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_02435Help
Entry
SLGD_02435        CDS       T01177                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:slg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2506485..2507081)
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLNMKEDDVVQFAKALVDVKRELTYCSVC
GHITENDPCYICEDKQRDRTVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPE
DINIPSLIERLKDEEVKELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
EYADEVTLSKAIAGRTEM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaacctatatctaaactcatagacagttttatgaaattaccaggcatt
ggtcctaagacggctcaacgtctggcttttcatactctaaatatgaaagaagacgacgta
gttcaatttgcgaaggcacttgttgatgtcaaaagagagttaacttattgcagtgtttgt
ggacatatcacagaaaatgacccttgctatatttgtgaagataagcaaagggatcggaca
gtgatttgtgtagtcgaagatgataaagacgttattgctatggaaaaaatgcgggagtat
aaagggctttatcacgtcttacatggttctatatcgccaatggatggtattgggcctgaa
gatataaacatcccttcattaatagaaagattaaaagatgaagaagtgaaagagcttata
ttagcaatgaatccaaatcttgaaggtgaatcgacagcgatgtatatttctagacttgtt
aaaccaataggcattaaagtaacaagacttgcacaaggtttgtcagttggtggagattta
gagtatgcagatgaagtcacactttcaaaagcaatcgctggaagaactgaaatgtag

DBGET integrated database retrieval system