KEGG   Spirosoma linguale: Slin_0040Help
Entry
Slin_0040         CDS       T01156                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sli  Spirosoma linguale
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Slin_0040
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Slin_0040
Enzymes [BR:sli01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Slin_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
49436..50056
Genome map
AA seq 206 aa AA seqDB search
MKKNLVFTLIGVVVIATLTSFMSLSTLVKGIFSNKSEAIAAPANAVAPAKSLYDFTVNSL
DGKPVALKAYKGKKVVILNVASKCGFTPQYADWEKFYKEHGNKIVVLGFPANNFGSQEPG
SSEEIATFCQKNYGVTFPMFEKVSVLGDDQAPLYKWLTDKSMNGWNDKAPTWNFCKYVIN
EKGELTNFFASKVKPTDEEFKKAVGI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaatttagtttttactttaatcggcgtcgtagtgattgcgaccctcaccagt
tttatgtcactttcaacactcgtcaaaggtatcttcagcaacaaaagtgaagccattgca
gcccctgccaatgcggttgctcccgctaaaagtctgtacgatttcactgtaaactcactc
gatggtaagcccgtagccctgaaagcctacaaaggcaaaaaggtcgttatcctgaacgtc
gcttcgaagtgtggtttcaccccacagtatgccgactgggagaagttctacaaagaacac
ggtaataaaattgttgtgcttggctttcctgccaataactttggcagccaggagcccggc
agcagcgaagaaatcgctaccttctgccagaagaactatggtgtaaccttccccatgttc
gagaaagtatcggtactgggcgacgatcaggctcctttgtacaagtggctgaccgacaag
tcgatgaacggctggaacgacaaggcgccaacctggaacttctgcaaatacgtcatcaac
gaaaaaggcgaactgacgaacttctttgcttcgaaagtaaagccaaccgacgaagagttc
aaaaaagctgtcggcatctag

DBGET integrated database retrieval system