KEGG   Spirosoma linguale: Slin_0398Help
Entry
Slin_0398         CDS       T01156                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sli  Spirosoma linguale
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Slin_0398
Enzymes [BR:sli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Slin_0398
Exosome [BR:sli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Slin_0398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(501369..503309)
Genome map
AA seq 646 aa AA seqDB search
MTNQPASSDKPTQQDGVYSRFSDFDIHLFRSGKHQKLYDKFGSHVVEHNGVTGTYFAVWA
PSARYVAVIGNFNGWDKGSHSMNVRWDSSGIWEVFIPNIGRGETYKYFIVHEGGREVEKG
DPYAHWWEVPPKTASVVWDTYYEWQDQEWMANRGAKNALNAPISVYEMHMSSWRRDPGNP
ERELSYGEIADALVPYLQDMGFTHVEFMPVMQYPYAPSWGYQITGYYAPSSRFGTPQEFM
KLIERLHQAGIGVLLDWVPSHFPGDAHGLYEFDGSHLYEHPDLRKGYHPDWKSYIFNYGR
PEVRSFLISNAMFWLDRCHADGLRVDAVASMLYLDYSRNAGEWEPNVFGGRENLEVISLI
KEINEAVYKEFPDTQTIAEESTAFPGVSRPVFMGGLGFGMKWMMGWMNDTLRYFQRDPAF
RKFHQDELTFSTVYAFTENFMLPLSHDEVVYGKHSLIGKMPGDEWQRFANLRLLFSYMFT
HSGTKLLFMGGEFGQTSEWKFDASLDWHLLEYAPHKGMAACVKALNTLYKAEPALYERNF
SAEGFEWIDTTDRENSVITYIRKGNRPEENLLIILNMTPIPRSGYRIGVPSAGSYKEVFN
SDAVEFFGSGVSNSQPIASYEQVWHGRPQAIDVNVPPLGAVVLKMM
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaaccaaccggcctcgtcggacaagccgacccaacaggatggggtttactcccgt
ttctctgatttcgacattcacctgtttcggagtgggaagcatcaaaaactatacgataaa
tttggatctcatgtcgttgagcacaacggtgtaacaggcacctatttcgccgtatgggca
ccctccgcccgctatgtagcggttattggcaacttcaacggctgggacaaaggcagccat
tccatgaatgttcgctgggattcgtcgggcatttgggaggtgttcattccgaacatcggc
cggggcgaaacctataaatattttatcgtccacgaaggcggtcgtgaagtagaaaaaggc
gatccctacgcccattggtgggaagtgccgcccaaaaccgcttcggtcgtttgggatacc
tattacgaatggcaggatcaggaatggatggctaatcggggtgccaaaaacgccctcaac
gcgcccatttccgtgtacgaaatgcacatgtcctcctggcgacgcgatcccggcaatccg
gagcgcgagttgtcctatggtgaaattgccgacgcgctggtgccttatctacaggatatg
ggctttacgcacgtggagttcatgcctgttatgcagtatccgtacgctccttcctggggg
tatcagattaccggatactacgcgcccagcagccgctttggtacaccgcaggagttcatg
aaactcattgaaaggctgcatcaggcgggtatcggcgtgttgctggactgggtcccctcc
cacttccccggcgacgctcatggcctgtatgagttcgatggctcgcatttatacgagcat
cccgatttacgcaaaggctatcaccccgactggaaaagctacattttcaactacggccgc
cccgaggtccgctcgttcctgatcagcaatgccatgttctggctcgaccgctgccacgct
gatggtctgcgggtagatgccgtggcctccatgctgtatctggattactcgcgcaatgcg
ggtgagtgggagccgaacgtattcggtggccgcgagaatctggaagttatctcgctcatt
aaagaaatcaacgaagcggtttataaagaattcccagatacgcaaaccatcgccgaggag
tcaacggctttcccgggcgtatcgcggccggttttcatgggtggactcggcttcggaatg
aagtggatgatgggctggatgaacgatacactccggtatttccagcgtgatccggctttc
cgcaagttccaccaggacgaactgacgttcagtacggtatacgctttcacggagaacttc
atgctgcctttgtcgcacgatgaagttgtttacggcaagcactccctgattggtaaaatg
cccggcgacgaatggcagcgattcgccaatttgcggctacttttctcgtacatgtttacc
cattcgggtaccaaactactcttcatggggggtgagttcggtcaaacgtcggagtggaaa
ttcgatgccagcctggattggcacctgctcgaatatgcgccccataagggcatggcagcc
tgcgtaaaagccttaaacacactttacaaagctgaacctgccttgtacgagcgcaatttc
agtgccgaaggtttcgagtggatcgacaccaccgaccgcgaaaacagtgtcattacgtac
attcgtaaaggcaaccgtccggaagaaaacttgcttatcatactgaatatgaccccgatt
ccacgctccggctatcgcatcggtgtgccgtcggcgggttcatacaaagaagtcttcaac
agcgatgctgttgagtttttcggtagtggtgtcagcaattcgcagcctattgccagctac
gaacaggtatggcacggtcgtccgcaagctatcgacgtaaacgttcctcctctgggagct
gtcgttctaaaaatgatgtag

DBGET integrated database retrieval system